The_Treasure_of_the_LakePHBPHDBOOKMOBIM 1)3 %/@.sB7D@FIHRvJ[0Ld?NmPvRTVXZc\^`bȾdѽf*hejOlEn)pZrwt}v#zx,[z5R|>.~GOYb;kns|{ Bqy0Yj  8):2-;0D'LU^0g|py']lZZz} &/G8AK3S\eo,xgE^>  Ҋf "",$4&=(F*O,X[.aa0j2m4m6n8p:r</>@B|DFHJ zL MOBI  X EXTH$ j2012-09-06dH Rider HaggardiAction & AdventuremPublic domain in Canadag/Ebook prepared by crutledge@knology.net,2 @   c The Treasure of the LakeofPREFACEYLLANUATERMAINCHAPH 1KANEKE'SALEwoww4516ww 2jBUSINESSNSTINCa"761623THERIALF #_W__170__4WHITE-MOUS/35249/5rRESCU-6508 6FRIENDǖG?GG94871GG7JOURNEY߭םߝߵ{228796ߝߚ8ZELEPHANTANC?硯591679EXPATIONϡOGOOu88158OO10WANDERER//k3181/(1ARKL)STORϨ߬5330' 12WEARS OATHϬϰG8558ϰ 13BEFOR0PALTAo___\425603__14SHADOW׼g׷׃|5363/״ 15LA MON8NDzST߻߻߻߇8132߸ 1gʹXAG7߿ 67 1kGREATM4928UNWAO76279BRID]CUR?60691 20FAREWELL__/blockquoteo>height="1em"Z PREFACY QUAMAINI0lannotememberhatnywherenisookavetatedIitasfirstme@deafttemptingoisMone,2HolyakxandDabXa oiupon,roerecisoxdinceromshores.ԆIf`willoow. OЎX)learnletX@whiItillHervqw!(nysgoomozaquhHgoaXney8nnBmiss8ary Xerpris@|orderaiPfȒIsakaccuracI؆quH0passs>'"ys:divxight="1_X8font>AtѸweigLѹ(1sQ9Kumȭp!YswؐHRrx\l˺oot1KaneMh-{MmJt m)pئrҞmbsaXleػp؋إQfe.Ϲ0bwAd8om dbe,KirlawqitimpossibYmA"TѵLH"aLmxhusA0sm owhec؏^Bia۫do_o>Lly,bHskhwhdo:macȉ:axaceograp0 i9F+hoh{l.:fa@iculeespecial9sh`EfeelfIm"fh.½IfȑArkaletsapiemphasra local qlshch;anysul [mlx(elظҸ 0wunasantadidںp;Hhnpew@uncanpoxzstPIouiX Xoepsaf83poioXmxth@efie_[0"pign="LLANKANEKE'SALE NBwhyo`alJeen@9unfome?ܢenigmxpoo8purȋislow-tPatu8ma螱choi5o1sx@xLo aIpXlop@riahname(꼲I#bcopcmyfe AfricaunrstspirgumanȇX!aask,iwo?B ق|bo𖫭⽠b?GGMih,`answoxiq@mox f)/al".ʹȜIE@pcXٸHh{otQ!Podixkl@Q.ًHycol(globzpedpelle(loat`n!JȮAa:QlightchildvuPbt!laiúxlrwx@БIanpѽpiȭtHbua۹80sax豍shrsY(sub녹Ytolpgumae*@f qxp؃:a8oXymbo+;(QobviѾ\s),dn Ÿ@ҥhrircumroyeSescaplaHnѰ ;D fпrep@{8mpris HPle;,o굫l//>Ihzxamp0Hfay;xuhؠ(a\Ieyp!ydea,bal𠊿 pa(nsi(鰉yatб o߷mys𢱒,gQ@>Nowq[)erxsamQi8counh:2C1pK;ګqnëpuncI˜( t.ƥ"ؐik:\Kal:(lekn ۫qinhabiXtsLas Africa,shole,romheeginningndtillemainsnknown.

Toisayreatectiooftenize8areuitegnorantormuchoimightygypm-ne(bour1peoplesntimeenvoyagėa8Punt,iIakhav)co(ry wow Uglookedpoqmarvelloudventure.g,A`tanceSolomoora"HiramgoldrafficthphiriKundefinedQdoubt؊ˁSstty ack3fala.uhyltiplyexamI(f􆃏Qmany?hi1ru}*ibyaearworlj,)itmoIinhabit8divid@;sinȎJ"rac|Јhbea kma0dr@lpirP,angu,ustomxdiݚmoutI ablish|pass!nnumerges?SoaxmaexperieYgof0thoughšnklarHۂB܂opinʙMlqȞ@h(wiISalways@nsrc8toRnd y tunplXsokum!part.ƙlehtИrho`IjbyHa82hiefcHbusss.ɚxaneYgoccompani ȶiH(ٺ9fafulottХRmgXFIdj nКmlmostC@xEaxCo03azarOhaP8ٿcIx}@merflephx fڡ\suxm" 2BelgiPCo.rrhap&Noan's;8|B!dllI.wo!@heeںia gexcHbeliOfiHIX¥@focuߺۂqyha貀JiDenboih>TJؕb,owѻon 2);gu(*ixifȏھkX@litvaiqiprob(yv9bulku8imsiAarryra@`esI upnewjgocyUnqInaa4!half:nciyvspYdɺҫY70gou(-alypa`rɼlQY!ranٖϧ>hp8H,e8bh Slake֖ayanzaޫmallca@&wss'bomuBalxdtb!wQsaidxs@ArabYaxHHic;˺RsomeKeoHbigh(wxnonxw`ro.ƺ(5<˭! xMY(nɆgXn)umeiBn2"Cgods",spiriifXm bpZe8`erP@OO>Now1RH!L/x''!@i9acler"xspokhfa-bxLlybeePeX|l2 BroRAmby鸠1ln- l៨m chre >CpsamXZep1 ichhelaveadoldrormbrose?nstantly,ndithusuppressedxcitement,et`orkAmakeurinquiriestasform0thatertainaneketrangwhoRbeenڂEnowchiefrapJofrabtlJomiftyileswayrom8ereHmIheseativcou(gh܀oxbouz쇈,PasB8QreportQoor1peopl0dweltpits1ders.

ThAchIdylan1 de(aconveniф ecauWellduourIachp-town[called,ccihlbetwtaedRous(i(mfirPpurpBavoionciheadmand l) 9(jney.o(markabppЅIЄ 0cla,ceАz!oXmpsvhagQfoo,we`Ied.lsroIexpriPcommunic ؄hʯXbaba𚚞2Iar yspoken.ȬhT!"high-"瓀ocЭyicine-`+ afapyfollow0erRs.curiYКflea`ydelଈurgoQQnovitiخa(gɦyNseiz(bivapفYeĺulsa"Q$hPneȪqɽ:w4erhQϲ>H aȿccrgqsq 8e䄑nPsuccmuqɅ۶>"H`yr ڎ؇1bhachHlif")saat8biغ "rzdi80Ja`@crueP2Jɺmp ٧,Hay٩mercbXQ[k)لl^ԕb.hdx:odewP+bushXacsp.ԟlfox2am[gBMacumazah(S;p ,(lQummn9HAc,Хth4@)hIy]g,ypsouj",aer-by-Nret9Bf:sȚikϼϗѶpro`c)X(#su*ou`ЉjCSchar guesz18car@чe(ie1drmyselfrobe͟YSguBtacus`I4s")Jv8nor1@;bpixl}jwo`lohyup2 `0ait[??"AdaxԸ)wn$visH㽀.ӨtaqaJ:"'YhJmys. t%'(ans高'hmQCofacqpiritHٔHng7>"opeY1mhcryaWoftsPa`ٴ8;tLI10TanyzbppiL.þ@@ௐ|\ve?,'heaid,Pwhoasoool.

"'Thenmassan,YIt?'sked߁߁Yes,'Z'youreTndyord.suoftw.'"Fortell ,hatomhadt,acumazah8IRsorrye0twoearsfterwardsdiojGoodI2. 'Now,(ervantscome1xswx!or,ememberingifdoieXfanrGPresently*headY'cameigXfowhalfXrabhohiisornydk9took dra ightQrissuntrucnЋ)tX.ȖIwstartedack''IĊ!4'4"laveanekmeou𔇙} 'AskwifrIk, .lsoכP"x+?םoN, husb``brok8{؍hchcr!cr蚛wayǡǡ؄Tgon(e`JrK 'Fas0idemayPgițpQgunsSbey9th@txpos%tdouble-barrГ heldrȈo/lyieyؚfsix 𚚀|)acoсH`flsol`rs.vsgg[eikfiftyЫjmjperhapsir8xXo8؅JshЎXI? Huddtogeyehiهa__YaaȚp2w; 'slipuHXo+cu9"Ǹ_noddedh)*ɴ:girl5x?? jphϻCzaؑ(ptain://|åR'ay`AurA)HPc's򚰊ۂW_DogWW'''In9artLi9maXarg h1oia`z0!gA-pst꼹8returnAz`roull{bodylexxParadisars'KihrpoAdm ƣ!`qlno:Oquie8??>"IѺl0|r Pbnhdؽ߽߲"OHhtwчfrienb!'.ϵsXdbigdg0ppa)pou.iH0riro2a粐toicexOjد,f deeqbyPwwR\ڿ>"Th0ѱvSyҽqgtockyPkPpݷ˷h,qck ي&bthrottlF=hSowa8ver.o8շkb1hrawqbecrycerlyU"'Verll(hese'Ioin¶˙A'0ond ibp`prep@өxprayXacc j umOOkbeautifЂ-rupsиpB8ic(ao(xshiomutterɮJppsoЯ(atcqo;ᣀrch0y؂moн(`ZtoryGhn."WfinCtalHru fals8)sorremarkabnquaialPca su@spp)8[R`@yrQї$1sawhileonsideringaneke.

Toellheruth Hwasorhstudy.iantfannize,unotnegroynyeans,oriseaturesad(somewhatemiticasndyow-huedar black.oreoverhaihAwool, vyt]long.Ȅeywesorominent,ound,lustxsSPyave0wl-likxtoZctenanc AXcualthoughlip&coarsdnohhooka`wk'seak‹a@dsjfeethshapelyێ@curi鑈tr7r leframs1musclesCageighXbeeyygtw(rty-fi(Tcarrixyye,ov1wiAswavigouryo>Iɔ!aoweҐcomd0mttioPhcharacter. exxordinarilyXrydm1lmomys0aihewh@repqe +ykpPpst.Í`emplathimɓlЃ{beli({ntasto`mhchy nvIڎsow uge郈.ƟqhphubxwhodceZlРRexe`e鞠thesiton.ٖإlonoوQt @disfm(upXnnc$ bHyIləott@DdA0hsted.ti)i (uch(8istorespecialpaX؎Qalh "Qm">"Wappen8afward?"asXl//>"O(littlMacumazah@IcHassany'Cgng';ˣll1rlro Qu(xt0fo(d(go(XIbSogBpeop abfȺ"rOArabHkrbIzKm ʷC¼xpmo0Ї,jseЁSlJghx- ؚqju-juۖgto8ed;kae."߬"Yme4aIch-doc`ai?9e0HSEld٠負 `Bllf` XiupdHwiAhzR0oD0X*[|0iqeh#gdic裓(@aaThuྉhelp2radr!prfuȪodayǡT h9 o}HAJbigجearHt8h:GG"Ii;hAAe =1"s?Pe跘؆J;hnx۳j1dIn2)orrowloudh?77>"NI- dXsuppo [excep@tim81*`xorgeXselnklov(8a_talk0ns,"dQ{hmar (0leep#k LҖPpl7is)Pp),@Xknyӫmugl0aroheir8"?ƴsyJXjoYh dpmun Hб(va`üborsistam(t㽑famoxoicp.playmat xډs"> igضru`word,Ac.OO1fee"nsIxrn2"whyq retu@(07g!د(`IXsoPong.ereulevereop`whoouldotisho瀨ithend),fforcedhem,runway,rhapsoison.ndeed,y_etPbecausamecessary9;protectingromirnemies*wiPbeasts,givrains@cano.goadsoHdangerouTmaybsh'iveycoHitsdlsdiwhat͊(ind?hwXmyaxr'ldes@o0bornf脐chieffeȅtosecre职8d"ha downusgXg(rations.ut0beebsentearSP(oɃakphplacMP elJm8Macumazahn.ԐmightillespeciallyەPknow ,lnztray ЇgodsyHnd4PeڏProphetvtIXAHyxart.thtYtruriskʌurʚ die."

NIrew pnter!Aalh!hdiscʖamyrђhsfrifas.''"Yourss?"ske"WaΆ''A(ttiwsea xhadPflat-topp3ick-Ȇr(anye蝙TCouncilcQYuphatt0ttanceKanekePtX.ȠȨalʠ)їr٘Xuxnon@nnrpup)b0cȎՃonk@sPQw[qPbXseخؠ`iAiAtkԋYeg8Yt !sngohҫ$orderAlHԬҬ@:ʤQM,䜐x gYbol1ue>youuߘ_>"A!8 y`a8P܍&!teaalߟ">IxEc@ʓtood8tZat ɶIuss0olem0Xpriv@Px`kCswٸjttRcy sot>pca@bacڸ ѯo:rsuchpo`wlZwх suklo?>Ȥ`¡JH lefȼЦhIowIipily,ɼJ!9*ilew q*ػde0mivڲyipeakȵaruQypsubjeXmporcoȻ/O*ٳ8d_7DI,rhi!puffw(Oh1member.כ`H ª2doXl?n qhؿwpYegb daP,Apި3yؿhrervaHansifZdxlA[ͳ(†"in0Ow1eoplؼaDadaeyoeuga-)xainsoI0ayq}AыBn becau`plegendnȥIit2IgepyJaiOHOnltk`#Ԭ{Iphwpr-spirhǴߊ"7:oqknH{XnIisrhn (۶"k1șׂcompan𶸿Hupd,)pass Ѳ:ѷ/bs07ǾDZhey[eekXjup0sibr꘢iد:__.82#Н|baselookgoatR|ayAfo3emdslopȴhmyselBre.ightamenndayownoleepnderree,rathwatch怠awn,ohatithl2IrescaperomCdarksomhauntedlacQfhiI@sfraid."

"Well,whappened?ww>"SouȅBInnotemembYaMacumazahn.piritsentye;Pheardmx-toph`abovOKpass`rougest,ingfeltgSPutknew0yreock.teng@oseood-Dw(erb Tipl* ul s.hNul..."pused."T"H,aneke?"asacuriouslyߧo>"Lord!ommitaIcriq wholorl ecQsaleg ɍ0HÔ8a77!ףHeEngoiodddsv9?staship*os(ThizfɲwXAž@ltenus.) "OrHƄI !knaZ(lsQis a8*cq[whyzIGwvVeryxന,sѵI ` lHbexcepQyhPAfriccultismpyٺkey. "BHdid4I@h5 y1` r-adad. м踐h mbr`Hxrr,,t)litouchۧ strleل fIcaSat Xȫy"Aappznn,e ,ani!w˧8'ly hb}Kapursu0voic8proclaPRC뽢 pgea.ex0iz3pasyjudgmentbdrivy8fro( soK@9xػsɊHmiepAbaslop\mt00?`csob0ve''hPB5l&dw3S#i|cρow˺ߺ">N)nsid$;53ZclusioerfectHcorrPhink9Kt. zexactffencegainsthisriestessayaveeenon'tnowndeverearnednetail,8oughbeli(attauchorsnhescribed.llcern Ђ:XhadommittsomealegiouriofaaharacthI,otwithst0ing rank,A!forctolyuQ2countryiordo؉life,ҁbenx,@iȇHremp@

Leavsubje8i)furthenHIskhim@oerieAbad0PDinlry>"L,"[pd, "yaXaeoplero 0XepxagesorAnlyomI.ԃye xajealȏ(au*engoi0srfruitfulason)(oftsu(rdrtscarcityjreyxshtakl LMon0sioimQbBirodЉ8lso.roiyD8i!ew,3genei1owurumberswindle.""蜹yvadd8feyou,aneke?Og>"Bh, ;ifDeoP٢h֞@Auwifa upcmeeH`wezٖ protbyJStapHen.لPalwayAopdDc`ЂS)conqu8usohlrmack!dHsp0AMacumazahIXm!mray`b>ՕA釰ph0Bi{ XnYriseI+¨oϓg">It@n0id:"Oʊhsd=.ɱ) P5sakmXorig:ǭ' w(ns?õ[sX̜bord8,bePa`9:c@AHw,ɠt*'? WmeanwXh_sa`fleSH(`rHlg`$xhanϥϦ>{er$Ygel sinЯ㟹hçoLЮJdi0iohAnlookoPp)HSe/ˤts'run(lolpQPwbipҸH0 kx`himwcìO y9retu:or۽*tf…\" (ھ0gHct) " mp8aAcrimSchʈC%declҼtBt*y"boohD$lly?"remarked. "W୙on'sappoinP,aТljysel LQaXrst-xsPmagin(liadea9infuxpir@linhabH<1+"dapt(18Xous.!@dIsyalỨ,ŸpecQutse-`rruffinthpme? 1robj,6cousrAcc@L wu`Hugi҃caȿ*ammitamur` ((;s@rsonxadv(aget0@fe(aI 2 dnofowJ b;ia`orcopmptibجrac(u)IKiذڶˎ銁hкЭyqu tYܣѿlr@HnewaPo̸AM"[\ܿьry@Iٜ b0! ruaby컙ݜP:qaظidp2r࿐,doubذHmrombroswПʻ`anygoW0ign="ceHr"> CHAPTER 2
ALLAN'SUSINESSNSTINCTS"Bal,an, "A 9mui߻v;^"Impy̓3b@wroXaf㹊tuff*tickD`I Ҽion.@#äZ[ "tacOlimselfpp؛i"|ruнZenarPtow.Rٛw9MahommedwqquoHp@qbeli#Prophet-hiQoRRl!soB"ImaeIZtruĮڿXIhuؤȪЭȢ݁fin襛lpQ@dcȯmake8dYw`#i palewhi`suitа䵩uenough)`is,lsorвXsh(ɢnzontwonnisliЪq>HIcfirCca@(ee-ggstoolzurXЫರp@y74xprobabxտpexHritdt7G>A1laXȥ Ackledhetewwhichadxuckopotwithnsatisfactoryesults,ndityipe, returneolearp,nu aha framefi@thatar alm-wine well,etKbe.

"W1BaHbeenoingllafternoonthisuplace?")askhumbly,atch xaurtiveyforaranooolreachls. "Talkɋgiantain-makerhoooks@knwlsnlightIKanekePperhapoЋwps;󏘂Pphty,dded,y)-thouWW>"YesIai"IveЄS,`, xwif(mPdoknow;deIevhȐ(any+."׏Th8I3XhnٌكW reco POII(surpriseJtruPoutkɕ:WWS you!nkQHans?G>dlirtytzfixětleȇHsP nsk8nє؞ÝٕțȘʞm)legf@te reflecyС0roduclcorn-cob[H1sotobacco.ԛؓaPglPewcoul0mohIeߛquisober1xliari(mar>"AwQQХf܇"scxim?ϟI9embYcigillagPeadm.ק¦Q!adn`concx PlyxhPjealousm moopea.irsAsat(ah3بq) eopas1!oq, e簷Stop0ol0w questionnϲϧ{ӓшDdHot?ưؐIa d)xfitaّ h0cQZk )غqlh-gaz1rc)girhiefI`܂gurdlЄmcauXgyMamed٧(3b@\CdrXigigXjawyparclۆy&:mчsleepͫdragrcliff Ɍtm P1rzpɻPinhexcepwIoڈ(񠝦+Hfloo0?drvڴx 5{stņrobbT,;kwefWsuHlyn Q4Prophe0lso 8HfrilXrڋō;XwhzmubiȜ`prayPh;,kfaips0_ѷ8IxY"be_">*sxpre-ligh4wi8@BkI,impatientxi 9yayШHSʶs0fgayrantfupwB1u`"orlHHJ(liquЎ0*ecret;(ercunQHruelӁ o8Od ȩPvoiceڃJkySvis9Qch-docto PpafbH@iv9*saٿ!onScagxHmh؝`ikлA$w, spiri"od"ftoge2t ies.XahBz.ɴL, ?߿߽"in(#Yc4brouadon'WSoсbлwP9,azgropw8OQ8d¿fidi*ͥ9m coPvage."

"InowothingfheortWell,tas@,aas.ԁjealousomanoldellbout//hy?hator?aresiga8t!Ishoot,ndamichivimresentIndeed,8askedqւIfs ithpaymsureK,HI(ink{xwishesouomew2QY;lionacX cag@ki)`selfnsteadAlivn䀑mewh) tired.ȎPpokeJolyak@w9)ear!?fA,llדדYepHaneem!insuntryaborn# hadvph)#thecaus/peopleroawaygg`Jus`ۓ qiϋs JbacoφȖ Zmos Xf iscb.č[̒}>"Kane@aok X7frai`hosP0ldow@ɥ">HY1tap ,skgai襈ded:"AyeD'da QprxyãP topIPlacXDãdHelm-winXPsick,speciȤ0ft0@odhristiliʥG(arrom,!mɨt,IjHrevȧAdi.as(__Ssa(toXpd+@oxaightshir`doesn'thtw;d0PsinhIÙx,Јleas(GrO0!uXnfe1ragqkbir= ʸhpxoeJgedar3I meeif#'rqui"H)ptt򑲺,ҐK靓 exisdom'' M9doyZfop,"remilyѳemberamyomih؛" shopgrh|XrA1wrouggatڻt(camsidpprp IºXH(ؠisadиʼalyridicuؠ 8trʸles2ɢQ(Roup^e/gp elseubfrek8Ȩ+X`circumIupon:c`exercȂ9narrow.ooA;IxYate-robHwaiۻu X8"keepRdohcIqy@HBarn"؅o>SojnducCvagidRi ث:norǔŘyclihwi(Xt`m,9drxrunRtohɨ씑sl-trrs?>Rb֔sr qu耋cheYbuil@0(cloconPpra8a`ubɨcevnٿbchieѾ(kpskinnbow`fAdeparɛopenimHfAYmٺ(f Pqb RodmвPlock4`almoxtialIhio8p:"EHXlorda(azahW1̀طfa9vefar.ٽQӽᴘd`Կshnewmes">NxIؠt *yrBe (m#wʹw Ifri."I>"HY ed?()s yanߤamȞueenXzHwrribbo`:righttars,orvenich,utnlyumble8nterhohootsndradeshisiving."

"It notllrange,acumazahn.oouJknowhryanfccoxaswoalues?on@8publicnerket-placwh8xyu`little;ˁoprivateKwr mindhaveudgment.ΊiIauld1acquai(dthseco8Yhigy( rl apartromealt@onRcriby alds.ȅ!Ito(am:frrnitych-doctoѐ9dthrougtfaIommuna8curiou;8retays?beeꑢs(fpoPurarIXe\wepꖠip`lso{ch.mongs txikalidwell(l ZuluYhiefbrpd,Pm8(ssage770Odixe?"Zid. "W,d'HdeI@almobeliȔ.ut,ieKanekwisoalkopee?ubssҗwoЛA(usHʅ e"lСW),"psi suppoSkeepshbъmy ?o Iservan@Iswor2le1@undownHѨguarjy8sSˍermixCAtnY:hIdӎjeȆ!sXr0BWW">NI閰H'efiHi!fxmbx0xYinatui]firti `vX٤9`oqtotieductipos.d2cropɴXrty9be8n@lishP(YȴstoH`afwms(@shapxsistapPa`room&ѫa´owferab`pZ8S[l(matȅanolasOQAcha,r-sId価ebony4Pack𱚿8ZixfoЯAEa0Co0.Կvi8PAbencaecipile ebeyeir(AiPW3Lwx۩(ambu+x]apyy,beрH˰@Xvel qnvitaIlpyXf,@dXteHeni; ameAquiPO>"I˽Mameda㙰r ffecLmisurse_>"MQazahmeHy.ĻIjXl+xw)g*0hasorЫ ё٫રhipPropheX¶ٮj)x8,ùMoslemc0 7star@1oȪȾVenhn8ahؽॲklixjXگ3dk7>"YȼykȎu׸>"ayshrugglX( zejhKAink CYwI9dk.Xreo08ma1ch-doctoDal3r@orbiddjPy#ulỬfre?djSquei8ӜȂm ᙧHsPdHl"1ev 'hen-Xd'" (`meap-maker) "hmach̩xGJLxeopPt s@ʴ`ll,sp(,xseOYliфibeca8s #doget.ߦ>"W`Psk8suɨߨߙr",ord rihɡisoeturnoywnountry."

"Well,hatsherepreventouromoingo???>"Much,ordhithoutnxcuse,sɄldbefo8sund.ndeei"impossiblefriedgo0s@beurdxda0aitor0negadT߂Peefruth;keotyB:leavespont8jwhrowiyrowߊߊGood󃨊@rrzlargHB*do;aI,anekeߎh cD:repute(sachȄ[est?ΆIdd0methwhichiQbeli,yeaЋamaa at+.isionsi3dizfas;푈over,@Zlook"facEngoi0who;artak`wisdom.inxv~b warnSkhelpߚߚIlocroa@a8Liagainst0f,X;I`s c+ϟYesyghiknbeyk.Ӎ wH perhapxlittl@mHearHn裠sleepaxre-caty!8mrunkYquick+sn!`pair-timeca@QbIJ??9㕳dКئyI(ati. ":tiQalk.ϟHoJteppʑ1eper axsta"[ѐ[ nswq:??"Y@h@ЭPir(hl1`pneAؕlacumazah’(holHiddlcMonPno񨨔ɢdesRolitsxX!lֲ(9tappet`.׸uid…n@Й8peopЃBs iлlZ΃qqYJnjneyHh,j@藉sai؎t; ailoxernsQPoipl"c+䶄USTin'ynȩso8Ж[ǥtaop4dooHa8uF,0Shadf1nfoʁSDisanged;j仧cdm9ri(oif@try{'REhYke8Xrph8iɹNy((ess@chawƵ k)le@rpLIjI8.߾"L`zؘ,ca[@un9bdܥ۾Rbeyo+afuflepPѷor{齪ZaXbradARhr0Ựou0䎉ou໘gladnxlx(h.ӳpoiX :[)1consua,accLZowhmodrifficul҆requpiYlarge8AI)hiHierc9 Pupp1asu`eminЮ(BnI0qsnaPal.iؕ(dPeignangl9gsdXP8AwXei ۶s?">ȟ HfriA!probab0cdo!͞IؔȱN5ȐooPigh(od-byEomorrjleif鸩otep3`ahﺷ麈Scatcoa"൹sl.Ŧq{dyours."

"That'setter,"aid. "Waveou?>"Lord,dealnvory,fhichh aoodtoreuriedwwpHowuchohinkbouthundredll-tusks,propostoendway nex)xoon.f9oul cceptomeathem>"S?"Y meanll݄hith1nevposormmediatexpenseoohHeollXhisyesᆘsighe@@nswep:ww"Well,ft@st8,XQit.omorr8yshAsee??">NqwentHhyhousreturnre8tlyaanvaagǂQoHm8hi؆wfgold."Takocct, "AgamysinessstinctsAohelp.ememberingfIoha(ngleo8 ؓHtrika r`ver tqXworthw K(GWn}italk.; "no e.nbnd(nmengparriX,invipgoanekeX_o>`(mpan@tiPbyȗQwhomdl8\situatio*8jjyyexcpadvicBiff,aas(yYget ygsnptunQ"dohФmliHrabp)+Ѝ ce girlsijg+psp)too+ahri8LHeگuleaZ'@sk2yond(z ces@ڣ9an goliv(mu(iIA0rbAafrH"Ceafoolis@Uough zart82ڡconclpwwOnPac)*gI٩㷱ookhrarubt!,9.׵ɐmopAai9feny8Pkr˨pd !'cs-b0kg bQhiddẉaAamthrf!lany#IjЉfudyI(:pieJXkmIadHhlcul salu#frmark 迊vailpowIy-fpHc2xspؼprecko޻ B700ckI)npٶg>TQ8 ~o5ag@xۆducy(r:8er½9)ownuntxeabaib8unlh(AsicknYdishs!impossiblqfA2!@rtoHtur8ЧByp*toyŖ1lsXoefIgZtanziؽ@HktrbehBJmprocȽPHtur8>FueXagHv+t0@ßsQeignhȜAؗjo0ơ܍war9t`dragg*bgoXwiABs [?%gui0ilCᒨwel3I@erP2tecPnryyao_>S:rlrasecxultClĕٷ|xѲ8i;j`t;crabbXA@icha!er fqacqui)2knowle;OӴraoͅakplen.huishl(ӧIiis afternoonoakerrangementsboutheespatchfivoryndsour(ney.

"Hans,"aid,orrennelseItalk, "Iidatusinessewell,It?ԅpfromplearnlwayZstriHwheYrisot.omorrowanexmightavehd`miчoff(du.""Yes,aa0 (eehthoughometimes,tooJ8rksl.nlythint_ZwoulYyououbl8Inhʈburied.fhaME,򃯏HitqDYQMUSTet placCpa :dprlp?'>"Atyatrepl,wQstaggYgooȈI㊚askTdependsp8 pri`uXlifeH9*flectively. "Fmyrtpdo"se0tus0helepiwor1u蘪YdeaOon'tvKffin >"W oJmean?80riww"Oh,hgexcepi`Iewhib؅ong@PahishIAls #YteprobabJwinprR0coas(:?eca1 ,Ц؝\,a٧E@!iJstolJro(YretimPr,usr*W,bXbeȑ(.owYQٰhundsoeigwhi@ьQ fuo)rvxIdRh8ariX'@shɌr mbOrog>H,nzbҧ9Ҋ3wiintIper`aAjuryɶ9(olj nn28`imysel@HXerؖeer"ettxw 0r!١8cuiadvagIo88ˡxiunnculti@drcompaamewUx‡a@dhoserqTprac@p1nsiyvalu@ece0!RH(:sa̷CagaᛲbcX؋QdYocketȄcienceliBlumpAd>Moh0t8wm)ctox |`qshAback"goyPtriouAaismiss4HaX1e2hie PÂ@@Zr8@hXœn9cٽ-B ,ego[:HISo qڮaTAsudden0machɤsYhapyCsemi-piritujfhЬɧkel0a޹milif outlylyџ!affepsrg;m.ץAaabbBm)icP8jc)PtRgn)s!u!axerci𽙜 vmiH(exs`Iaccou㥸awarhoa@̡#؃0deˍnxdo=f8Jre(1mo؏"H㢺asarrowqbarbX.ͽ9Xxuwa: `QimJsa yerdau@FaterQel1Ҿz'!aQHi,̸ۮ ) aDabopldorhenvisitedhoresfLakeone,ndfeverotrwhatitatter?llur(neyingsust8someay,enexonth, zyearraecadeence.

IentjHansoa(lookiousaggrid,erhaps moavathianyods׃>""sai"IavxupitothaneDabaountr"NoPYX,-Y3beYJer.Ƨ\t즃poinюQader(PnЩfH9nbhus̖rfafimycharg쪉e8r8bТuiAДe{gg raAqIump@讑P𐀞hur??ow(BJwabGGAIthreatPdRhe?enowqnpIᇀeakRqseparrom, fght8qRr#palm-)myi." (n,adafX3dsantioHy*,issAd闯:+ok-鶠:h8ʶɎ,?oQIreҕA{A;ritg-bye-we--t-in-hehnPQHaԱ @o,ix¶////߼lign="cer">THERIALFANEKE+2"lor="bkPb>IpapQdetaipc)r)i`t-5!toXrokZanzibaX*ʛPscure.uffi(ْ̿xৌHrBxpotogeڦat8"gu0wIQplxfTtuskм@Ilt ghdeclarbe3ѩaelsWyxstЪXH(Hm࿘ȴduurchfsafe8deli9Ҹؗn@wh)ac``inpucxuAammH*9@⏨ocwhiwIQexpecaXDurXmaJde@stl?">p%9Paq.%IYsuhxiI A,rʕJa­lere컰pepr.Θ1­ixcvlbyrab{Pefu2quiNotAnns09sawgirHlhyimagH8Hpocrypx.ɭXIiÇ̽lgu۟@w.ϴ@yeqcaupromwlHLxuph,licobea)#BlӐvmyy!1XsaLarپkeptnnnglishanktanzibar,searnedjfters.wondwhbecameft.

Well,hetringYpors,eadbyrabsountupononkey0depaddereoX@seen.eoo,rQto.ȁIhouldxplatmyollowwlimi!haXith twoun-bskillhqrsoH0m,ob臩o@yecommeЄ0hhav)uteaofessionalig-gtich†eromSouthverylHe!aservice.nsen,ppdnbyPniPbirhaonnceablHIhristehimotghBnativesa+"LittHoles",uhisacemarksm-pox>Tp!Xborn a imi9,rerhap1EuroHn؂).82tr@Ȓreyritq[aЉrЂЂɆ lmostaigh0dhaiIlĜcoursec$certilsiЎzhiQformHudlyXgїnt,ra~educaZt>ir0Michoolxsrse((-ssJ0miahackso)zmyqeC,idea m[diQe f@p儙H8ooȂ(Hr8uassocixުxҥ"șIˍoЬdƒLypi "gay0gs"EGeorgdays`mBrme?¦mۙIb`ag)omewytwthyty.kC؄*a`riybelTȣWcofa s*bripeP`IOs!ɲZdabȟMòXKrbloocH9ogX.Ifri| HqRsusiousanh ,pjeala0swpaiaccorddIP;ظ:ypܺlephantAYakex jnaQo`ñtڵѾm:Bcg@Z𲈖#YopiunirehnPavoxiad>Ys봰Yougo-QaCb\Qaadvutouca chiIob̫Xb0omma(gx8'smet.͙husgآalkL)wifrh8 sepldaٽq wr:dIpr nuqrcH;"fami`"YRstop;nٿbabies. Rl+8eˬtoJsevJaӶC0__>Wh"atd:anªҚS<Kaneؿ nQaIdpoHsg,view}dиtripapodivȖ`rppteaͪq.owջ1armaon SSʝۣDŽy𔀞n2lxaiѩoi(bbq`ow@Y>"You ȡPstPn,"89. "&.ypsPwruhhonHq¼Pakn)X x،Prpsuff̣bhIgogggy,"i:ٗv@وxrx "cq@r "zharge."I9miponsػ1csw0 <, roteHhbyotVirgMa ғ佨rb'"uesirgd, whatevertighte.henheyadinishedirrotestationsurnoans,hollishile2stoodywirling ithuperiormuponuglyittHface,ndskhimfeidotankXPshare.

"No,aas.0amgoц`takeoney,oypouldByouJh?Oarmancswounter!)'suardiapp@tlookfzreHfaHrwIannyf&,yɏpashzrPdo."TɁЈarcoff(c?inutchichZ(^und8tp:"Yjealouill-condi锐begg%Ikeepmyself."ԔIhil ntuhrew"H+wLad(besidesomJerry abouwyvr}greed,ough yubtfuo ZcaloaAs"d(8x depar؇lnxobservbKane8w@YЀJn0exact@hwfraȑ.emetadm@Qvag񡐒Isxntexplaiz4pposaccompȡelept-o triP c0reQduersXR`imX(cehalɐdd-B`ct@Xpnumb򝪟raЄٮsE 8ˈHJЃજ`pray"nKwTQjzwget`n">HreligIpeop z0ranmixbejHPMahomsts]Easto1savh3tGaikaxucul2fierce-eyaellow,qui hArab8\sh9negro@bpleap0pdenoupomostensib0becau0j@8??>+*mytoyЙrem{PlmayjҷAkato@speakk0gӵҰ/5broup߼>"WibackIɇ?"skanLqb1؞hcam9o>"pڄIblind,". "Dose1s9kA*lace?>Io1 f*bHlpir0mꪬtowo׻pNoh!d"ɥ"ۿعr`gfrZIY8naIPch-doctha( m#p*ِ9ȁh.ȿ؆haaaoʃz2bJbЧğSdtHپqѵxwhAw`away.>"Howyoun`thrbwoH?>Y__>"S`iIHicJ౪eemÓasleephYaskoJ,auС eaWSQAsC6adopt.فQIx mosque-hli,@x$ Powoh!RapphA+AiIЫْxpjlot̾HFQH ݉Qntȫ%ruHh`oo X1rdisg,1admira9flec2c doubZg )buspsxB(rK@xspi8Tٳ2nopI!por0؟aertpabrmhYu0adI9cIKfratsxcorrup)ods H.ӡ wSToAJer.l{gNexar *h:coff`usualndaidnafashion:

"Baas,heresrouble.anekeaseizedhile耣asleepastight.heyrointoxhousetihimthopes.temhatesterdayfHnoonyhad`quarrelonefmkillhblow)fist,rstelzz,X8psxnghx."Ist askjgoiyappen.//"avtryramurder morn, accordheirwhaventfou llere ial.׌ysha Iy{?>Atr8@hinclinxnswʎ0ouPnohdobussbut(eflect@rememb@ّxPI`sohsetwnfear;l4qtaken'vopgo` eyxrHSoijoatteӋSkmyrvants'`t9ouhҐl8armef)(u9gat唰0؜Kqlac`KTreCouncil,ch,J܍,odutsideagФ marchTiv801populaT,u perɅJr{h0peoplassҧֆؔ |Pit8HowЙ8xbثdozȩHte-robmen, er0`u(sPwhomkPjudgexsom0ʅnlǜs adcg3crowwardѪ Zstdubtfull8!ri0A1giv`eq[r-rCmcYQit @#retaribe xYppPspeak.Чs؈Opar,eavYQHس(upɔƸ)s Ȅback,絠dbixa #r)ylupcqxbyxo{f"aariam9y>FinXJsuasi*)qBU8㲺unkءHno*m[selfٽɒBnudp left@о1$quieؿ8k9figuCI⍒oH,ؔxp:rycompmehem`zSams𐳼YbeAzmoc)З`ȷ񿘓wwjDelilațBb(H'yvjealouift@Iknew|n'HHoYigy0ʺpaxeveryқ_ZyHm@ owed.ϐ1s Anoi,P,кȺmy"d岢> "M!an"I+shoceea1Aжfayayenux80Gaika{p`c8sttornPGrChiefu\inonseBasc8raЦng`omnalavHelນ8špan-mu`ryѶP1`cunn,ac0Aau ritإ cwd񈐨crim1Aru::ouli@ bk d0.crueltoppHsh0, b2w辨IwbeɼBf;xoffsahlass:e`cy"gslawProphebe@chtraisLspirea7amadabehyXlFaɶ诲Pc XmworshipZtgo@evild~uliqu,(otUϟ~,hdnsaflambpinfa@9oth.asca@impihargѽ)Ljlb!0adaPF rЏJ!usurpPthZdeaodth="2em">Havingettledisashnifhion,eatownndalupoQerisonerolead.

"Topurpose `it{Ihould,"{id, "seemyhiefudg9dneryeclameuiltyforerimes)yヺcomm`ifAldorhundIyears?till,xet@IPsayam i)g,amelkxa턘yXerdquarrexhordrevPmromPabb!at0gX8rutIidoeؑɂ!,utxfe)gro;yxwAllah`;HI.ow]tyyou,eo,yptriaxPe havft9ouˆxynxaateqwealthJoo>"I;` Gaikaa@plaX@r0adP.ood.Ȗ*welo.n@pr*rurov@YroteczX.חJqneay? [en.ƔlowhilzCplotImXwayxs."$كYij. "Y,iwacpZ0Зh,acumazah*0oylep`ts. i胐YXraiPagain8urib9+norXVƨȑ:faPr'8J֫seizhei Жìso`mslWe^ÒRKcqʦ @+ʖ;n褸llsxptrxYyHٚ1 y꒎(pirdl!(wJwizards׳_Ыx`e bIaudien@r!uraphus!RgXalitimighkhanyevid$Ipopuhylock.kmadi,dwi adH𯼣hBus:"Mysær8r9I1ЛYl8Hi9sٶaDహу4's9Ҿqk?g>"ӹxHy̎speak¯1ogehenbؿpunishmXDep߃ݟZak7echo`rd ">"pumph, "µHdoJ9P:{ askmercȧYu; #y(Һ0ںё+doubtbeʶ(giciaПzleyunbornĿ`wմjYrdRl0Spfu`?despatcho)seback" gx(=ȹٽ!prIollakHProphxgiȚ$رX aϕ0hX"ybKd +clubzXṑsٯrbl(.Ȏ dZpndG">:lengp$spoP.howf, quieпlmo8indiffx(pXoi*nc2mi08پmid!ep؅Hce>"OۻHog3PzondaXqIbI/SAw`ظy@x\ufrI tsSt,ibsHwisd.ڸmypYr2PI)I@h sPXuchIle8Putur(IdaurxӮ.̟defUcwMahHɽ,@XJ:grisickfIinkiIgYon ڹ:whIld؂jsa1nodd"w8"altghۏpbac(nе8դ 1leftyips" (here2wasensationmongudience,verynefmtari@atiseighbour). "MostIyouill 8ˁPsicknessecaus0fterɃbeooctor.Ԅre fleXwayyscatlikeatsPthout`do:takenyow2sonndaugh0sdsteal, `omlaveȀ."

8n`urnwards @added, "FarewelHLordacumazahn.ft fathhinshcannotuideb茘r@nP9placHouldp,etear@t, spirȎڂIwj#safely,niv@ssagerom( mhh`oѐp,1chsha3delrÁJperhapsYnPH/!p`)kʓliguHshoBrogue," o.Gaika-b9j2 olm13servants.aIlyo8arq"ti(A>NknowၒIayma8noswpeculiapplAghȁPoud@QmumblКfit8 wisءng.sHstec8)usualmtإКookAuphimsel @ci smen,Y0debaiArabic://"igre@l,!mar,Sinm Kanekj or虵gokeXH`⌄alsaiSAok,Ibe2k;(esi(ɨmagijbe(p h8iriediniȩpan@(">Wypaiindign:R0bhbeeaH p:Yx fiercjcrb׭>"Weױhxwli`/Aleap2q-doȳpl@mischiefgainuGѱ @[@xAQwww unprov ul؞هuriouqRh,fir8LittlisY0 h0((see𞼴Pxdos)ta uffSкXAȒHi fܸ88phecwo1?rZ ,r*(Zinmo(sXpQ9`xhiruth?Afbrupiconfus.\(ȤQLguQ;hnwɢi)Paenfashiadcu;ahsolenAɭlHroupliif ar!Imb†A٩JmWinch8re0 `ptrrehebac(b{owre9hu ce.??I !stopl .μ@g𲉮spw)b`,ЉXRZfѬ elvelpugangy'Q( Rserv9Crow@ ,9qlo؝ϻank:Io0!blatgun@c-poammuniU"wbesid*@stٓid qJڹYsȕecli굈Knighnl1(W"d>pkeepcɴtrekɿȔaL[amppػ`Puɴb٭Pr0蘩Hhof"jlopt0cqorreplsamrprqh80qʹlsoxdBusPragmge0XamacPomappiAfrica,ehindhicheouldrotecturselvesfecessary.yheim(hatpisasone႐mentpitched,逃laten"afternoon.eelingrimore,ɂnk,romxietanxertion)laywn₢usqfor lepofof2untunKanek wisg@u؆IislikedmaȇIsaveim\`Ilievoxxjust,seemimpossiblfellleep,cxdo Pan.n)2curioureamo㈣aȍ9noonderful,1howmhoccupied.

xYrspothoughuttinctly8hearpx,soicay:"Follwo.oꀜllsouH8`Ҋ"OOTwم Rnorkn low`IPu`Xrarbawakenxbyanshtgofoodpa@ar.nooI(!dnighp1umxrQiBldyivClqa9PloudlXky8ewiaidq88ww>" ," hpresl""dmewalgؓicknʋBbBomiȥҡX?w>"TBabserlitt"swer. "D8h隠mpeopB(caravitook[ivoryOYe2;|yrhrlsmel@ kepbmg0I hadو!Ih a9wo thr8L:pybov 0irpЛ7Sm-pox?uggestV馘ŗ^0be Also1hqbQmix17vѹxqA9vzyP*charmtoppaم9rqȻBڰĦquIaumbPnsqnzafTbaJshoatȿxda..new:ZwkSäh+alencBeasooponaowߵ'xsAd as;{âɾtoqFa mڹ +ѩynishJR1'rinkl@assi(naڦ0nncorfashionw@IifIrrhapsno#.Ѐ(toge{s)pwaiJ;BbahenGG n="cer">WHITE-MOUSEׂ+2"(lor="blackb>"A!eXpgupWɼC'sealouiflik8YhomcWh0-́eH@lcȹQAtsupp.Ӓ<@lɡbu ,us뢢tyouO mAbo)0;gg"Ŀp5nk[wi2bga` ,?yo!۴ft,jgG[ichioPcdiȼhAygly@t@tеH.q,ի>"B91йfirsP);l80*xȤMayama`(f">KڸŲaasywevI,@no!rransضqok hisdvice.

Whenadinishedyoodeyeoatchfushhatrewoundool ttYaslopebouwoxr8yardsromcamp.enteapreslAbeneathhtreittleomanlidAsoilӅRightXveHahost,Rststill 9moonlfallingnrhitebes.ӉHthYbackPh covbhead,eveaZAface,qwas0intsy (yatty;loiorHrabIouIusEur80bl@〈ktYh,earchِx)darkpeyes,nuddenselfkneRihP+kissitgg>"Twdo,"sailiftu "Wdoounme?""LordxɊickhpow,mpassio9vo, "I)Al(Kanek1ey(W-MousslsewBianoHrame.lDh@atbadly,JveadowȚ(JnoS, `IupaTyYwoul1 i@shimfcan.>"Me!>"Y9."ps8twpquickA`kn Zm8hrkpaQ妐giH,xcepy).1b gerv98Ɏymind.Ȍogɉ_/Don'tfr!0PBaas0X0HanshDuysm(>iniddpolb{б0by8J:ww"Se@rlYwP".Ž!lease 08tTʗlr(`RrhAzdOرQs^ ʺ2,yxxmonkeȻeXsgHpwqacts!"yconquobeпj,RyT s:ѧpaXupkzҿ(C8W1X¿boi2)risrf"NPon't w*firmlyP5aqesWhyhoulgimyfHsefyervantsory9saveaneke,hom耡onlynownoreek Ptwondiayellhatisnemiesy?"

Sheonsideredeoint,Ynsw:"Because alonPanu`ouʄKdd`placei(r wishgo.>"Ion'tOqywe邐articular,"Xrepli)estily; "unlesst `backiZanzibar">Agas,"saiG'GtakS'voAgolpLordtI(ncaittl04wtoo0{ymenticГren oifcouaccompepoertajourney+@skingo@pretHo.hroughault2iYsnab0`H|re0ڗHTwe`n!enmerch@-fashion.owahreasPchki9listeYshhelpؚkI,lp:moQfair,rlS??>"Ah!clever;"(Baas2heardȟuttflectivel0w聙Pdyd(ry>"NqsKAfrica, rȩإmuHogeY!iУ,׎I-Mo(.oY0Kmad@laGa䏈W7WIseєYc.Ȍ8(k:0 Ѡ鰪KtaMacumazahj2g8at-ed; 񬘱raɨPtaf8oexXBtH`Ydqi:а@o(dr;r:ooۨ0odv u xo m1pspxsm.e_fryȠ0ی;scZhimself+watcjafؽṩkne)di |judg+storٮ truےIry0lg{[traІhne{beZYySofin@eUn:᭥sŃxb@ypirتdsȫžIVrdoԩ TbKe8 ,}go謘Xobussap`way">0t8q)mals uht0:w`BmyriI,udl8wHknifigirdth9ope(QoblifabȁPbYtsش\seiz0r0."mustb8`(H!exclaim mЗٺZyIbWSݾ"Mؖ؈Xh. "u8;DQp?f@I㿊9ye St ,Lxm0ِZٷxsaȚhcertaoathqbroPIeept`psh l@ lFsnctweuscIӋ¾Yc@`hQe8˲8ooZspawڴbrighoonlRfxndubV(shba2Ï, in-foѹd(curlhai̺aisKd7g>nDxɺQgitHr`Hadicul!figАsuspecxX Q`l);ʊzackg/hadowic,Ȏ!a4age- wisd Aetood(usacingachrikeeop(acenalay,thoughtameo톢isif womanprepareoiepcaus`XhadHilnftsapfromeath҂hdecl‚Kt(whyǃandy im?wonde )Io:tryv)9sopersonaliskzyself?lso XIouldhelpanekxgs舙taken?ertainlNimpossiɋowHimmol 9fashion(蔐yyes.8miQaq!knif@buhm:i ec;`0ecroap9-druAhir`">"Gada@r,""i"lЖtalk."Sunpsp8Yhife8Qgroundsx`fo8upioh*??>"Linwentn. "Imx 3o08you shTan߈ YehLor@alreadhixPaceliesmilaPntly>"But,hite-Mo2@tinu)+ ooPcerneѢpbusiness.ϣqsuheiv8xw.ansstaX(@ up`@wunH„4JcomX:msuatknBepi(҅KowȀoOktukYHoxntoXaunۜ‡fidZgazip8:"IagoInڇbx@St)9rPYgso,pu#PAPp=Iomi'sȶefA9so. pm>89-mp, 'N``H'᷈'Oh pIX8#)ʉbeRwi*m@dZ( upyXmrb̘hsö=su9oQw(wrotix"brouhosIs(xI9`urڵͧsTQJerдpȺ{ċdrag?:…IArabԽfo꿡 @ackYfarRoffI^stXHafQbPKsAph0t2uPq׮hea-woHWsw?>"T9y0a(ouia螚,. hd{ealguarmPh\cwhisbo.پП?Hx є;Xde@~H BtunnelȦquickԳɳ8ꐃDOr$r$gzbkyd;ɴZmovYfqscapīS,”Irunpo0jo:fashѮ۳ʵSc(tir4beKmٖgun?AxwrQdo?ascuriiiIicjshlefelfl0"Oh!0QknowQedpaHsngmH",x,Samsl?Ĭ tshi+my꾐aSperhapA4p">NImembQ7had!kH";"pumlludoAlۇc@yXbɊ\peop9Yȉ.owphxpursuKsubjectidXitʇJjimantsoonsider.ndeed,etyselfextractetailsromerhichxnotnumerate,ndaminezschemefescue.

Whenhadearnallcoulbiddingheoman,hite-MousremainPeIentackcamthansbs!forԆJerrysrelesXashioIHlathmustturnwards`peaksa op@is؍0meecXlyp!ttPimportance.Ԋ+orˆȉҁYer@wXouPbeeamarXR,aeh2Kw8yvisgePr}littl0hoot0-expeditmadxKaneke'"kduik8buГpauwsQcb苑,ⅸhang"food>AltgɓpytXb,yai9fobmynstrucqhȈabeH tak0fetқadȓ8ighApRhim,>didisonY{awayZleepsay8rPbgQ2)havrefaccompan w9jeXdYnk zrk#wqu fSoYpad;orr{evagwdofȞ;r홀Xrloasbablycberr3ir 8bellgu싹s>TldSaK,zbPlwȬ>A:ppo(i)keӖPdozallef+tfihSwap@ouPcsuthJifew`r-bofXHceaHmflaskspirittrip8Bbilto8drimi`ca5 CewҜ򁑫.ƣrmYtoo0in8sc@#pocketfuldgeAlspvolsharp rknifɀڠ h.QrifYj邭+a3pxnd|box9aGG>HavBsu±lec y ubelzШQ᯸yg@8ilipʅZushsol3usxtrp*emb0Wh(-M2hungYW``no`)Po lPEĉQlu8dȺss1ru¬ sttalZaw*leanziP aeO[eyi[fir@ĺ鹰 (Q)Ўq!figl0,co诩sA)dH)bYBqbu iof ĺCɊ@@),D:"NaI "wХfreȥAGG>Iag+Q\#flЙb9omanla`讋moonisp1>"L,Yey.¿ sf8ow⹠ qsmP,P)ud."ooȌ{, i:aa§˷XRar8fhZxOroIybaeamftsprCЀqxnreڤJ!dhX)hmHorg*Q*sloIup=hȿnds.ĠѐR.r8vaorr⬂ؿq@r㼙sQyu cꁼboX!Amur9re(ctioinyy>"T:neBaa1psasleepwo)}er iP8pdoknii"nQdon9Ա?9bexprett8PerhaphBٹpksanX8rallyzimpossib(gi؞Ȩ@heeldndgly,Rquiteossiblefh8soungjveryretty."

"Rubbish!"ɂswered. "Iaveaycause, Iadot,h-Moouhkille`erselfKforteasonwwpYes,utmqbeenidehBgrPm,xthblackacrink1likehatf@eaa0Hcahe9GA t.ƆXwhontssl:skinuЄ:hasa0threeonths Ѕ su`0r(?>"As:th,),Ȏ`,indignly.WW"Ah!o>aysXwsometimeschangYhm.hattXwhiagwwordne,;e hupoptP8sIKaneke.yetaglowalklionbopGodxs8eidȑq'aidf8don8Wh xn,,nles`s%cwomanAsucѝHZqbigy`aHemQyellow-tot?lsozsuallkstoИItrue?mart`'li" nPub0+'if0me??">Aqi0@beg(0gorg8)ouru turnњȣ搠PonrlipokHussPnO Qsgla@饠l`'h(Hera>VsoHdescKzclef`t[provkugaKhs two0ndfehigha PdeepesTbottomXhrunriRstrew9aPr@Ciffj᫊ma`gr1sdHiculXEspeciʋoscramo)of}mHlt!cQupJkdbXropicalRbtpalm[ssS؆ZdDrIbh8tunatejneK¦ap0bhaxh!k-b@k聈t?H2He. "Lis.ou@adogt1׾">IK1;{o#o0brutIowl\jyYYzAfr hiou@ide0ssicircumstances_>"TɈr8ጼstudy3Ppd: "P Ii0"p.ean{l(h9plاngthO7">MotoIremaa@mbalذn迀ٱar,iItpcroh諨bHyatز`bktC1ftgleagpb(patBI8Ȫ z>"LordQ, "y(godоuྀ,hsao xhiy(r pɽn8Why?Jm@//}$wha`peop 2Zaȶcr iisd8 d;0I؃tbe!aнataorpsGGSopXѿ(a oloꃡѵĕtiudid:WW"W +c{C?o>"On·8aHaf3n *mak8;ȵt`hP骷?Im)xitIrk هsarcPly2ɿȯɫRvmos9uchZcivilizfɈ98ny1akh sgoo mYAҢYH udѾȯ' 0turcom)H!wa­ὑ*dp`QeRn0` º؋obser??HheaЭub.Ģliкـssings,ord?"

"OheWhite-Mouse,houghon'teenybouteustow.>"Yourerong;h9them.hepthickponoureadshall0it thrlif andfterwardssslove.m0AatlessiwAlay6Oeryin@Imure.‰0assȅჰrsanekeunderstqwhcsld+qforHtrytoNo+perhapsalepll.e wha k(nJng.not4'sealf(smadцllbelix, pAHll man'xZoanya+ <go8kfulwhomrᑩIjkS掐ra`way.Љ̕ДeinRcomp[lp1agaܙ.ΊitJiH0work7">nokkissetrememb*ieltautflhlight) fhbreawhsweeNexbeck(oan,evbyuriositpqgerpfr0aiQclpairfAatt8cfTslopxitsottadebrahd ؃torrennHciYdayЛؚf8[b.׃ٓobu(mid@У;)argper.Ȓ٧xt٦spo9s8,y:WW"O1i8st)0hۉeffӓ:rekسrtopmophPimpo(ژx"V.,"errup1$an.ww"MyXp"*wotaknoXifyrd"|HuQ@asl(Ϲdk,bdoubsJ1fqHtandrin[_/yyHl볐birw`rselxi3eggxgasomiso,sboiżpcĽ/ZlimbӺ`kus hape.oo>"AjybawaHIsoberj)\?i>"i,zell@ȯpl;not‡dԧ”answdylЃ!0mXI zRMJLHsencPtPB@ruattem0froJwn.δbll,l@rtw">WX 1did;י)-M[goIźIboulderndulledsideomeoosXtones,evealingprifice,ntohichereptfther,ansippineforee.or;wayaw 0thearkplopefock.hen,80hadaidQcaslightachusromskyPcau8lefths xn.ndeed,iw:woЄre@alxnatlengthf sb.

AjteninuteisimbWhite-Mo`sp d:"Nowz8lunnel(gins.eshlPt steep."wwIbey8withrtudpPrXntlyZouaat0bestruiS$f:lampnar@nwaaffairipalm-oilutArabsX=day+t. ,"itsseem8dazzi.yI8whrholpyup d@lmohdicularly;u toДpierc2ipsolfiatverhu gorgHTolppance9beaxby𙰈ugp؞@goapAhine-shX,qlow8primev`metal-workers;@8commonAfrica,PyIv(nydmMatabeL>Aws(nogleap8peckIIHokp1)8sor(bufurgumqur.p Pn8kiKlad tPl-plac@er8 n c@gihfoot-Ahh-d`dѩ0oSmu::fanoQb, aXk@0ht8ڒDGIׯMy08nkImHxѯyC:idIshyselXnyCelZbe@( .ȕ0noowAf;鈲dxcgؙʵ bus sЭpemuț\ɠKprayr@rcbȺYn:oo"i@w)A,"W @. "Setkfesltrbaae:KIgxpͮ⯺_baskp2 0OHhipohsetfiorthզPsQ8ftZIw身xorarmblYcapreflecJsequڃ2wea)MoXh@tuA)cȽѬ??>W̿hbew,aspjJ-Q|bapAbulo-hX࿹rJP½җnleft.騈(RgنrZhorri걐ne@@wIdHprbWh@-һZk aMY??ȘX*tru1 xQk-t׺>No,s 8o۷xMqyascend|э/BrnKtom]yeʡ;parkzPgaٷ(wa"danدolf I2aIkIDo!@ce;9f uch.minuPcaW`pupQf쩢il@bb𜸼re(HexhضRbed!п+Xl-rdpiyebso@anxiet0id0tlػtidat8,,imagHdi*(@cel)it(@milyww>"aasܥ1swm  Pb, "f elpeo" bhab]Ᾱ;himselffuQ.Ƽ0seehatappensohosoreuchools.otven1helpywnatherouldomenZisolegain,speciallysXdon'tnowhpaHHow@r,aas,"addedocheerfu)forecretgreeingithans,xmadeoeply"ifanmine-shaftsupp,nkw1woritpsveep!Brclimbpibaundred-poHagf qoxheirckth(Іus;`yereChristiZlikeouPrdidNt,gȈtumbloffwep.hondyadiafelys@,alwaysicearememblotszpeopЋGdrh(i."

Willblihdyittbealaugh, anyatmilؖOKkneԗcyismqHsumΕ(jbryluckyus?ƖreJh!warme荐rts.??Presenffwx+zan#xPhe@ppȁottxroppduYcaHˡxecolH-placeyWhite-Moue؟pxa,_>Says*urnG)ardlighbt Qpeedۋ0c@ge9,󦰠g X0O>Tqqdescstrangx.akȋb0nds (PerP`iscop]觺faoihoo0f1󉄍9ashi2PclAfdroPow)ӑRda )XQi8tt ƒ,ur؋w0IquC.Ӳ@iqlzn;sfiguآ`uxȧbsurrSdarpsѺ air floapmid-aڬaman. noesi7>"LȹaiHwEAtut@"Iw$catDwhP0ud!r.ɸHorky st.λHYush+*Q ڤPtyXhde Pr,;upHIironm0edgvsp1larenohyBc0bgalad엪sO.«ul,Hw1oqyoup8jpenӄϊ+oxhsHRitϣ2 ma`itself",u[1Can3afromb8?"paskxiply''>"YɘRiknowXowimpossib0ex8excepɓ{기serhapsshc!cdo0t`oafr"I[fix󯠠@ьcshunl`Cpull wayaqu$*qnswm4ҏmpI mk. "HIaB)I?olh (bh7Ϻ̋thҹprxiyf(conȞΝ:!^begb,ȉ0Lscramblٿbe(xOxaIembkiн wPP@top*d p1amasm!smAlH 9@gro˅hIu2eeplejIsiyزɶiټ¦o*fA\r8. @d$jׇhieCsafetbeQreck0quitwȾafeZ{pYactualunneprJlefqsomeer0+(=sk"ign="er"> CHAPTER 5
THEESCUEWheneadecovered thhite-Mousenfastenthea nromr ndhowustoutood0laddHwibroung8lmostsemblingeps,hicha4edgeftp-peoatooklike olioof,XPllyas2bottmovablene􏧐"Examine醰ell,"xaid, "not`Ithis'"0Aby!it.ԊeforeHleav mprn1mayYdy Xndes;iCbaskes94fHwill2Acourtyardb."TyproceedQoo,QHIbd 9hidopeoo@h-sؕpoi0IǕّtmlso ;IPmQsomefrayyi)thoughin leng(Rbe`bou(r2Zgras`aieXcloth>Nwi-darkne4mypiritankqportionatelyǦg>"Wa8Xe?"1dW>",ord.@gopTpus8pޜXIldoun-climbؘԓ7AcreeHhwBXmuKane8lies,pp{8ccsz)awakejxwhouhiXx,ArustЙ)sl(,hkRh.ouzHan)follrotxXelnPsɓ380eapoР2ȓ9xsckanstrio ev scЬ˔patien!exhaed,:8phh?hhv豐mAٍmphIno rHHXcuroby(Hownattempt?߱>"Firbec]赑Ac)3 qdXiet "SPndlyssaXsX^ɱguņlH­1RkK er1thser`aertaPagxRѫ!inq

"OXedhebeȔ*tal1DtlIyyX5٨cLtoriworkih1Dyabe@chˤbeauty;Pcrile(goss." (z"H"hPwx1tti(Ȟcomt.) "Bmerciful,spȭ"BaashbropH, "P alkҪ uffXbr ssprs'bsPnse.ӿ`wantsHr܊Ѷ!IenxP٭azeoicwsai􀐼trȳDPk"b(kclimbв,Pwmubei`n, akAԾHrtW'">H׵@park@ffec;Appsu@;gf@(selQat.wwX)advPX(Yacumazahesi?*Cc) 󃷿>"GnI,ddJarfollϱxexHhi wasunningptithanster els,or hbeHe,lippedne.ayddh quitearknl er,hich*verynpleasant.

Sosomethabovwubackfeltreapofreshirmyac(andookwardHsawstar чtkyDtm@nIcloudadassrm%gacomt,8oughdidotnowyqsldWW>I chtopA9ˆa:Wh-Mouse:vanisJyscrambltocourty.henEhisȊHidraggaftiml_ebeca[Il@nlyeHaSm` routesestoep%memberjwell.А@PI0fa0up@rg@8rifleAdy;,pidmbYpialґŠ9revolɚ//>Awbperhapminuteeh rggidis,؂@ceivedgaarabeyoҖH؉h1:.wifq rYf`dilighqafricIdo.ΘIˍCo0gwtebslow ,w bb`iAgmKaneke0˨frailirlS0HђiPiecrop ill`iarmleg:覐aknife21Ʉa9u(imiguѦ wo ,8zthrewho4oxleepoo>Aؘ>Nstuh xS kneګhrashKrecQPself`lPsXBsupn=ntʇ.ffⶊak{ttUlixahosZ=B;xdeedqbelie1objeosonaDf}suc(sfulfX!(e Koncern 0xѶProXcryPНeet\rHo borgu8r,uti+eflkn8yXdf p(zsak5mtij.}woflitɷ,:"Ix!w!elpLord!"GGWq0hylad8??>Am`haBificbbubXosgueت{r:*>Ikn`Qy??>8fromCm8k׎leIicʮ lla Iwgo0rtime [rapiditco jfoyQicfabX@¼f>"W's'se?"jidn',aaalڟsȎp;.__>"Oway!!crie"Saxlefpyker">iap(ag xlȫH ggeWW>Tѻw X:_xharangutPcomArabercely6ykgxbeH,vcursy*mImaginQfreXøyucPZoPAonл|a l. pBmaictio"tٿ0shbackE;-٢:)muaHm bp٣oipresuP!`i0u3₨ uHnrowxeemrecʓHragxO@ed'' "ę@A܏jAh;q1ݻ: "K igno spozsickn)8骻eÀdwayhetar-worshipper."

Theyameorwarddoubtfullyiftingqirpears,IyidoteemoavenyirXms."Gi8myifle,"Ʉlled1Han,in!hurryghthathaPistolLpocket,Zurposeeoetntopepf:ladder,ȃhencepen*m,os*olBmackillhite-MoucoujouYe0BaasЇćroelowabegaolimbwrgawithZBhiȆPxIjob,8caitumberPhim.bentownfasq*rasp,us erea9lthoughsbmanagSwatchwgg1Prty?>Just0f eruch)arrel%WinЎ@oeᒱhknif `irattP. pn)urne0fold⚣w rowdrH̔t.n`atk`uld[㊭agrkbЍ, ~8whiodpdgehsthre0ePaboPev7p٘ՍסIlasdiviRáescapy8indenx!imsibRlfl(rBrㅒmakursupal.orr(f࣠xЦy[fzPI*timeawbftMsuenemie߬oKtYتXng;QQtssAy튨ei)w(ifcX8Qd1 :Ra@,4IгXmikn17rJ1foot)sawyqowII)0ydubtlytunQmTwistrݯk.$0ru0ѱtsow.ĪYaang, agQdarkw>"긂ri"bzpHHhelp!tpz!>Hbey:klox8Aop-plaaeiѪ)tsidHyCup4wibܦR;𷸿ir's躐.וw*\pli`aolworutlyoul d 9rihX2rHL%`Kane0ȦxrԿʊܽeath3sq!ask1on.Ѝ kepкR:Jonbelam fioPon8 smbЉ/bdiX߳>IzZgquxfo( n0eggevisayc!BTȼélessknesec8enapcuwoispist¤ kydupatieiHwd:"Loryou2wcanQ.eli`;White-MohɦXpJnIlpLcaez!a8hy熩ho(itsiolclosMorerѾJtiert`t 3:daY(a[!possi)liIisalso`soسPSa𹰡 wahopn̶`aph.g>StS"sfʕRaн!ɨp꼈ffithP28hiyeʪIum^Bpunctpenraghorriɾ Ia 1,ersnj!Ilt𚠽W,Rx(i԰"pwaIgedel af0iqhÀeaddernhichetoodeganorack,nact;utothingappened.videntlyIsomeayhelockpsammedaitsr,r hpspheIitJbalancXhaHroken.onowndqmatters.

AllfinishiWereelpless.xthato`womanoh,!w)ofr?ooIeturXd`-places@dowrest,lmoseeg.ans,observed,mu sastatwithoaibeiimtineHefthim>"Baas,"ix"ifYg񇨏yholeohoul1v8een; rsindefHkillwe@0White-ouevoagXhZoserophet-hipigeheypodl kC3*eantYgetselffrom:first.ЗP,gain:__GEېgr,Rw$buri@iPoil x(Arabmhdo8t"a;Caix$ow)!o0pep yeaSooklȗyourГHIfar4ѡqDo`Tamov?o>"IХisoIPsiٳ abk?Ȝu aQygHO{liim`ryAci".Μwȳrap3askYȾ82mack˚؜go foll`mģԤЅxstopٺCreprsins?">pai0a(yspeúDutaHZ)O?>"NchanшXmڪD6ryaval stifļ*0yfydHк̽bɿ٣¡f)tr؝15wYOO>Bjpuzzi XQan@ifix~𴙒,Z",ڣbsua `itiAitsъrfupN.y0afy4.ale9queoJolnعayhXɷ awaroPunleephZgz0sßgerr!exhHmliralmoapiritualŽs aДnayerlarProuypёupward(1":Iais ؁ҫ peey@nor!@m{BceaHW9listeiH>Pt d *Уl0lXnzic>"MR shdoBfHγ9tAPa `f𼨲+; ΧagaQbenormal/>"L @O(re៛ankpXescapeY񘠍bynpi謁ICtRliIbil("a!bgre de(no1qx՞RwocO׾gaHHdozknsh? ϷBecÀauseou!rselfaidhatheusteeadicouldie,hichfan."

"Yes,ɃsomxuwordbutowthinkhasenpeakingoalthoughtayHveSherpirȆRwLooke!",xarated. "WhondiPor,hite-MoX?ي@fa(ter?>"No,̈ ,eit,"Xswx8wittliver."Th8who?ell(H rupIdoneȍ__zismessengfromywnIntrya ago)commAoeturn).Ɋ1c" ʈ(Arabst0Џp,拸0y<familia!rHmxkgicbrevilpoemAp@,anekeϖBa@"oknȍ, "finipdt>@lamp@rnsPionlw9ndles.hones0pnoR"dark, 񜗜ruex>I⠨ firstuggesknewroa݈qlhimܑylast>"MyegrtiffT #"armCrecoI`__">Hent;II#imoamazIsHtnpnfsndȚ Ѓa2edg2pYdescendrapidly,x Q0sseemҏsoccasionaloPChfeet.Ώ1tijuɚpr ntMHsi`BbAeer҇hidpewH5Q0hllw>"Wbr;?"kHdoubtfuTbXeMwe`lotIi'tce2n[s8geysafeq#am ginnbeliehXe.oyprayer貘starSobeyAKpY2tail0orrib0ӑS8pH2latRUn tunxagaIH(farЬп sa+蕉lefJbottomh@Yan (aXciaJBgrhdizzXstr `ZyllcijuhnoslippH(1;,havB t;˫f8ehٮIaoH,#ع8sub(sciselfAANQ:"Rmbeif+P,zzkpуdPbr9cp8,ҬntroBfaculti٘:ɲ4 it y u8JextK82Q.ĉש1retЭ؎ofso)a,erhapphysicalari, ADbecabjecrfyjdک ! :8hIexceptsit@tȭypal8)AHsure;2I۲0r9ken(ډqbe Zupwar`dxe''>AtaGoQXhVp_0lopassa!r籠e`@wXr)mryt(cqpAokBlpͥTȑycram( declivitcomparati(eo\amhoinclu(busԭcea it߻߱8sH3r0liaX;pi9pofȔᄪZaw#)o`Yg@bett:myywr-ٶ@jcotZQ.hiddyelpcjsind½jatt3drKinsuta;nar2nÂ;S6IlgladXRswowDja__W 0ta pIÀtoppedim,ememberinganeke,houstlsoethirst.utereas?eouldoteenyR.anspinthatadolt8intoomd8-placefwn,`petooearyPrguHrvenspeculatepoHmatter,ccepex0nation.

AfpweinishcoPtea\itthipbrypieccarefullyeasurҁplittlup.Ԉflaskself,1whichӃ!screweddidgivB,nowtemptrovercÍyBQyЊ)ropgg>Mure"imoyhankJc0saavescaQIp l@f#kclimbpthulampspoPWhite-ouse's`et8hinkWhe0ight@xQawards (haIoeepїshsouidon't)nyamconsen@etarf ibottom#erehgey,os#rekback.nacYpmdkXa)ou`KtillnsHsfiedshtrfГžcooleePrXthos(ndlessche܈h0>lpthusgagQhnpH0rItonPPPce@SloHәeelQroliaXtHaygroan.y0uх#sj@hurhurhab@rd(x+myOAgriedhz,Qmayca-separێZPhyŮn. bow :0lecCc!im@b8PTxleaaP.ndeoub0reXٳˇjldreer.ertain IwaboجثÊiwelt-mit;430@ exis@(yR@*èisc m//>HBb9py(priv9sorrowP𕹲0颠aQ>"Soouп bexs,"said>"YLord@w, "waiBK̡ #:tad."".׿pdifficul馑danges. ޠwoc8Лe"Rincbd" AthI0lAi,?>"Wfalwayeen[oide`peop鿹Dabhax(d5HoXLakOЎ4xkX)beBͧpxcsuick ȶcӾˡ0 aArab(`enemiwAfoll@ ἈeB. "LȴHgA">offwnZloyrIhʯsohgorgIxe8truth,uxindign˼Ѳwo yemhxA`JX(trmyselfi(ϻ"&`walbشx,sbattlؗYpؿ`ghglo@t@possi荬s՝ymtrva(sufferPyPsYbehalfټ0nbrunPiskPQzxaؾg9Ry"_ҙXb5Xb}Н,` ,ifbp3IeceogSRmPXvorygHmhbIP(JRmin϶/tve lyQal19dobi0`IuntillaccomplYap:decxstar@iȴps*ƭmgr`,u2!so;rҞpnk nesiwar@XbslmXYprp8;Rtoll Àyououldotelievee."

"Already haPtomeoodealhatove,"repdharply, "soerhapsd(ttereepArtoriesndromishtoself.tyate,canqdesertbprxnt,orf idqsupposXh1ArablackguardscuJrroatYes,ori o.ogethwell`stXem`wisebpsepad)ykusothrvantorplso77">AfthientnnilenchHxn wimolatixexcept挀l,merggoca(knowpe8ped.׈truckbea Topenshyountryusid0hf, piif@owveXsist8whichahinHm٘begt@ fp.ccaspygrowle AH`lualongzmopYirtyaHpac#rightakicoXh؄assAbe (eswiؐBahclumZor`rePwaylayx.hآbshHang!8fi@fearlQ2ab)wo:hosc(gSoxJdetaavoțb.TmrrixݍicwYawhБbyT4smocrouchdAp "`f{Pspɭ(wnatul"ɤdifficulcircumvgoX Xnd??>NowQSxacc1enavayarvznimalsanxioUo`remarkhicZШ`)"-man"Zdanekwonderfuiz,hKexpdث8߻>f3x藓di 㲀fхi(legtPbx"owayAlittlrno$mrphi=wakep"say"нafr}kJ.¯ѲIprxppཧqui8unarطm؊ ȹ8ɬ!deqal9e :BhaonȜomewcrub0`Ъpa`betwiahaQclwatmazold(if(d踙eel1sQjunQۙʺYs+!improbabbecauʤRXꯁpsH9. we,8prudɉpre!򶑯1\icbohXوs//>AfѤIaӯdegenerȑ(aelp@ba`painqexQKnʅꍸutd y&agXPky0Pkon\(}Rw,doub8үyVeG@afAsɸ8[㥫:Xomo8xrie>"sfqr pp8NH$) womwyrenIesh!go󤗸He pagвfBaaqyctiveDup2xfoe"OrEkaddA"j#miliag!{s_Bosh!"xgrunh9brubol(ill7<`I1k䱳hYnu0uHBhavkknIЫbc9aS,elemptyday)'0Jnamu(Danieڡsleeɱxgo">IuA;^08d Àtoalk,uttumpedlongillresentlyeame heitefbphich1hadeftaronapv@fulightdaysgoeem`be.ereounm0rdersbeenbeyQTomjJerrygone(rwardithportH,s judgfrvariousndication0suXtacooking-ire,o0amo臀nour(ThYwh0dfollowirrail,Յbro臩easy,moonl.

On)march)cc lHalwuphmadwPyXogps.t0ngdawnЇtؒPafȏqunrishByɐ Qsa wQ(s:2ܓrIappointsp0aboPhalfHmilmsorockssjvoliwyremainha䒨river-bed;bed`perhap0sf,c)"orlop:jXvelledpartȄh0-rhdrabtwx0m>"NPa(`h,"said. "CyoHaii[s`e."~0ign="cer">
KANEKE'SRIENDS+2"Xlor="blp8b>Inx؜(:pick-me-arm 38aodenemirunn@Fcldefinjbjecjputtnp‚زXxistencPpccas,#nPddenpeltufgc ɲ2-lbe调lmo@p.ӫhi;woӶthreʂqrnneck€IGG>Ascrambpobserɴjoy''akuŠ;alجpilst`ѿpaȯJ`dow9orhKdraggrprghogesyi(Hma.͸Hosxcᚨmؾ"faLupaffb>HavgnAz๒ruSTlitIb@x,lv hr.ȴfoo؞ mulantAxminutaan.hpYf,,Ӯ}I0 unselkmI1l0s KanekAh+bolJ9m0dz I esum1el-buildI@needfupo@`Haides0WW>B`ٹBeh(· r-bircjaaw8Z3V8Ahcӡq@@ckyu RifficuliQ@mxsi0lefowe@aPyleigriSXpԮه@Hn(8ph!folhproveІ K@ bgIno㿻"ᅃbur`CRoilPre۞BA@rub.׾YPozdpshotҳȖfe*@ W0vڤ Z2ЬrZC"nk(nity ʼíbusinbcƀaseasopeless,orfournoelianceldelacednhporterЁatnyatepmostyHm,horeoveradguns.nhHrnothingodonexcep ruinrovideandighpurdest.

Weo9j,inchrepersll爠whichɅsixthe,naple!boxesiammunition.ԉheavyameifeoad Hk1reserv lsoߌht-`gpjlo@acHslugԍayffectiveqmeeta hRnptoHaXPfi@KanekthI틺ex1at댈ghimA.ȓxen1dturpAntlyayɃ3]orkwrutdoworx"Baas,"dH, "kCskuXh`runwayin0anaYslireeds."ww"NonseIswd. "WJto?wiHkZmyself;xArabon'tiyeȔ7>Sofclimb(top"TqEl9,ord̖uie#Iaalh"Peasuh؎anZCsa,Adw*Xag">NdP8؎tiaxHnȁaIصd,txAmmyfel) .ӄl; 2Ible-bodiiA ۺoIЫĹLksuppxAartri h@P[h//(Byw qf:xyyx(nerouevelor gr@`z{bolt-tswirXVtir;ؕN@wmbeg( ipurpmiȯXpbȏw0[fh+ڧ9fropYfacTZsoy `llca2f]Vpi8th9z-ffecpprkequA29g(p@@pr2goYrdoBЮp9@ Houirxϟ*an:impxgaig">A;۹hal,9nZZhܟm8sulax.f ti0caëXlaruHatblp[p@ckeyndkerchief fyromG ݅twyӰuboma.ȭhuI1ٝAophct6isjp(Au|1 eZipBZgl(>"Wado3(1eopwant?oudoih `m@recognizijuѯJrKanekǽ/MasѼ"ȄwizcLihPlawʊ~2do2.ǽ]d0al،u8l`׉׋0c0!X9no8alfBx84kY, 1ph"oo"TiremiIYdly. "APr,Q2`ll-Mo 9j8߻GHInot?H(وer?׾?>"ˀByllah,o!"exclaimedarnestly. "Weave0tillthatitcthoughtsrueishAooo.omehowneonfusion @lippfromurnds, 0icanfixher. thinkChaudanwl flowoatan,astH"

"Doou?0ll,Ƀ_tie.ΆXtxhyʇ!anekef@م runwayC ,eavingʉhwalkrnoad?''>"Because," swererabaury, "leftcursepuwhichnlyeooshbd.id!hhm ȀP br!alagёяspottsickrokeXutisoalreadyxnyre ѐdoubtlwidie?`AHYmurdʒHrbeҗ0us蓽)TurdroybhᕉenemiesהwooonsgЗ8wo hwoulQnSe1moߔSڛ`keepٌQrisonerOf,hitean.șbe vsincț amo0|tPdžՂsɎsidn`@kAM1eϜϜWHdL߇ߞ}Tapectselfmight吉a9qmagic,oЅaersȎescapRkbuxQ{.˛igiȚaupii/">T9xertainsoleabAqCɚXk"qu09p@m8ack o(CIWzhmpulpofӯnt:"IC.irstڑ8l)hbB鰑falf-bre١tAttim)ubj1Qufngl,¶lgitqwh믆Kqud[bocp2-Moy,saYcgga?rodurstho ʴ`c8n`IlifpO xmHak3b`fHh3٤pkes9se,cumazah2teah2x,P ndq8;l8rtWW*stdAfrPض!t. r) rurrpXardpeoplzigzagSw,f@‹z{im.Yoӹcuncфlo@ 8h,u0Xemvafraid.oo"Baas,"H赪0"usuaCwr ѸPCsurre8ig-ey wizqЫһyr@leoos,IbxshfZI۬߁ٳO?9YeI9ѯnRYTag.u`[wP'hroatHgo)cidoesn'tememb;af8p((8ȱ8?𛉶½HchoР!Iل``р頀br9 aesXлPla@َYa)p"ifrcomRҽ sootDbӽkmonkey-skiocoo Ujeala@t yȍpgܻcoaYWSdsIugYxȾI)ћ0X">We z@ThJerralKanek)gi@ dssedZHsg*Hdisha8YprospܺX ixʁ+hlegmatic,Bkhehrug[erA ret`ioXotX!(iyayPꬸf9s`ʃer.s#madoparkȫ\av)wqLhqᗶ Thayˀou,"nswered. "Ihallemindoufhatfeeetne(ridX)eun,r star*worship.owleaseoorost,ootsraighbcaadon'tastertridges."

Thehw0jhuntersadturnedromYirligiousxerciseseok "laceach aittlhel؉Irocksorrangcoulirv fencboma.phiddle(ithȍ8*KanekniTJerryendsuline. @rouchedxpecting(ntaltack,uIisiddeveloAf1oȁk*Arabsdqew9ta0 4abofpdyardAhi|fe`rHrnt knȄyrnxddenlyqyegaoun'oplғ@shavpaihQb€owј:lrassKtؙreesowAi @layplefev ntH esig8ftfkyus.__AheSscacm8whom XylPI0cogniz:1nomYl-tempGaikaqo actyshief-justiP0'rial sthreatem(Yd@ivq1PX0likh):se@vul,dilso,:Ǣ"gohyenaWWGqress“QdowWin0rpoc8x"Ln0Xi! cri{I{ihylip-8mar8`hdpస薁lb0"ani cceg>Itxѡbmomsrb풠Vzci৉0gain赊ky$RڣQyhf贲eйqisYgxaiXaiswu1el󼠇 frpij Htiullຘ𬘨#,rab(o血yselfyҟdggp h!1anxYlyzlugbhCne@Ab;hjd8IXaia ihappSwbkܰp.׳Bw)2wpl0#(oxjMlitill>"Ohд peopsiml`XadmirazpBʶp@*cepH(JsHshi𨡂 sorЖ1ho`agab̻`pmoPd@es@u@o˿j//>Fq n)ompantoٛt;Iyhʿ7hp4yd leavQǙw[c@ɓdp)hoRwlac=uddeBcauTmheirȕabttac*uŸIwhy Яiaп@\casbQ8ӎJʛ hHco placHP¾@i`clum`й@behȥunkorArabavesث0pairxxouseh\[dtu(elttemIeturbeµXȮzPBonpȾ+ammuniZr(awaysiزX.ӥ" xXohPg:ruɈ anyh ($.ely,@nupѓfHt,XhXcotQbeerc,Ksʭharmlyؤd8sYk"pebsd(@8Xgi`, Hi1VespeciyfgmjsZndbxˀeadplinter,rragmentfock.heretched eganoabbendowBagaicryutitheancoul0llrdersthreatseephemuiet.

Atength,fЁisombardhcontinufnlywoours,)reameclimax.uddenlysoughtw`commHar ros(0rus)dowslopeik!bunchstartlhbuy򊓂ankpoolhiIve tionefollowingtastwoCKaneke'niymdrivhma etowRvaniǍ>OLshohoHm눰wHZHanwhofeegitefula0o,PtInowrI)uqryQstoprc:c|萲qP薋ttyuromhiif:,p)h8proiatrabs?ׄhappe IȆZkpSpletkdideh).erHsߛesca1bco芻bearmsfoopmoHdoubt0S{susqh!FAvaki(stHunlessdežptuenslϢ">N蠨pson*herious.ȡiIЙXZٜhnkey;Zsa0Hts`*(icul"qllig)c(@Donnaa8lf-brPortugueoe𞊥 nYIqgeɚhAsoXz1o!di1oad.”auHi٫t!pfHdrmimi𞁘0bab؏waightfYzuoppicٲo.30do?~ginafe`lpsuggva2xi萉firKZhCloxgraWtak cohٯ٧xHimprac`becaLe o UëQ;sRDsoXburZYbtrIwaySnexdeHwuCexarboltiiQ9u!Pخ Voh@УI9K.v(ȢdarklmocxpY҂diser;job1le₉agammunnad0Yrdzosalaix¼Du`*Eng#Y !Anew(Pi1fsurr0Kanekeoo>"aldyxyou]P`gs@.Q8iIWh -M(8ps`[re'11."OO"YeBaa"9@.ω¿blu觨ڄ7QettI)xac#bIliksquapumpkiȿؼgdihhaian'AXopg дl H(9(tal¾1busP"yPl@F»qIАqsP#eli8ngmaP. dfin (c2Q=Q,HcepxZrflhel8f choЯZIperhap8es@xanxj1e1gOIvydelidmselٳAt9atXzl[ist[a`tZjupI@!vicxzkHpip">NyI8ɾhuro;ba)1Xok)iȷwXur Шbrem(XhomPglanc(xdespXyhspn1"brickb!oٻ82igi!S tenٴynthsome.ƴy?oɳЩ"", "xaHaѐB:SX(bKaPepole0a9PcoAˀheingersfneand,nderrromhosehoteou,utgainstmveouarrel,xceptЁrccount.ԃportсfledway  aenemies,cannotho0becauthe@invisiblQeedsrgras tan,XlPwaitarknetottackmake`8xfs.owfKanyorcomf,peak, h is@erememberKXdie,Hlso."

"C !" answer`h dreamyashion. "Oh.@)now, LQMacumazahn,"RwenlistenliqspenxruptahousXtHyomeab8rriviales.Twtoouchme;pance瓹,(dssKane@languag1i8Ill`tHc(ayamongoؘ orcthH(臨sorryhadBfollow8H'(viyabxim su!ؕArabGYl[dapǍǑmildl"see֖di9White-MhoP8meb(kzx he?>"e IjXlppisowomI)deaٚɤ:a @bA@ztalkaboȑP.ȞȞkw[.xSanama'agmyrpI,:#replistYmopvague٥lybnddeX("H! ear,ilif9ڝhmpiI٨(dropaȯaЦ8bulledcrapskoffڳ獵>SpughY+{Ffɱca1X(lipI`beȦ",oio9e?r 9+ ed*muHrþAselfgg> 0curiositPɚPuicky᫑xp rdhiewNki HR:WW"Don'tsturbQ,aasJȶnX+tVS`.>"cophalfpmi8any;idio׺Oh,uitHasiacYxڃ0agicijtalk+Q`IóxbelegramsR躰Na`eWP,@p.rȠ0a saawandevillellgXRot!!ejac!(Ȫb,(lesZbl1scr9 att! nQeywatnt тww A2qdvanchdp1මoi膪""(pBഒivHWherucR8,pi(|xgendetȿSexcX,Eynexacwo .eay;edgeˀft,heyaltedorhilendeasir(dong,upposeoetbreathڀpmp.hentmeignalbegagai ɄplunginthIreedsikeogsftepntH.

Upthisn:rabsiddridoeembwaȉ approachecau8ntionasirmly8xupus,"kept x8i@koppieȌHdesultor ash.owas,froP ckbelaryellsfear,XrprisearHextiturAnthPchayHKaneke'wn pp㋔runnI*lywopresHly8 m*savagttars>HeavenHwIaac!vh )eȐpaspkaceЕIwi8wilursu$`heels.ӗPghkill9buAlSvanish`oxh0mosmst@Pahead.ansnQshoyIXua`j3e8ryɟoaretche`Jo!ȚIfqqouple?0Hab on@ᑃHdaIРР0nes`=IimآGaika)strq3kp§[perathjCY0lmjddg">A8Xbehi;rregularitixkrouIexca0wojbo 9,n fo)4-4 uiIu ScskexnaHypliquiplPЦxbrief!Uqlja"fnds"9,lway {該whhimizd>"n虐ӸdojnyAs,ord,"!aP"ulanecessapp Pqlive,c8 IL!p yxᵡsou."Ǹ"ARhx適htc?级>"O Jysxn{seoȿѶ`istaв o`XcorIel7ybreԇg8`HBaassahYDuX. "IPsigoopumpCruyHlt@1lfC[(hiעpsQgre)Iro(\ubjecinپd8 idb٦ڞRt ee yz)to@+ۿ9dtnocp)cdrȽ߽"Bu7oXzunusualmphasi"do!Ykb騹$I ؀`1Ԁ9бQa˛xnax`"th门xolqalguȬmmunho@` juȅ@d)gKahr2nxԏpȼ񄉾*P hoPۚiu hoüjhopʡymet.ƖXaumbs(abWpD3?"gadYhprovidh. Yn0mpBsiҒm8r;mea*doﲧCert08oB o9b ungratefulػspoticknȦ!mounee.΁Icpi#nLQMwOHx'! !K1enktPچɻooѹmu`)ssummq de@a̲( d://Ksx[acumazah̸͠ U77 P!(cas ˀmustalkoyriendshenheyeturn,ndakeertainrrangementithm."

WetaredtachrorXseHduiteongime,(oughaytasnlyXfewco.1on'tnowKanereadfmind,u0IhiȂullntioABsPlccompanym8̈MonbeefȀ@dhmercieȃ["d"tresPngag@Arab-hu hwho,щK,膀sotpassYEuropeanunpgar:.NXi@e`giveyS)ledgeɍ8s􍠒bKof8rksRdiffhnce8twe@am1ool.Xy,)domJfol鐈tiguoustlinyvid 醁veryЖ crookwhi s 1icultoBblu*assorxI؋xfrʙahH)Д,ʑ;stepart8sabyHehspibelǛ">I taxlooʓ閉excepalPgacitI Hstr)z`stickIownidl!def;F hre @quep C;Ibla`&m HLphsumm頰JparpularHllY٦gh@e.ԟ8rlyoporؗevf8escapw*aXЋa@`Almoimpiblysam `saiao`Ы*dcI򰈚nuuDillsknof,ealowship(exienanױ>"Va ,"B1 casuYwixweitbxemb P,phecfhX-MȮIIruss8(Wh"ctruи(mPI0ѣY.)ׯdoImu*heRI 9.o@t g8o7X YwѶa`HIli|drylywwxign="cYr"><Y="1yTHEOURNEYׂ+2"lor="b>N!s`(Zamho:8xamplZad"(ac:auPw)ree-volunox(ekskip,sěIs ta֢ymyriPsmȺq5"a9IfxHfu1detaitrek1ntҟ@iprac1)tentookHtX+nths i0a 68 4XitaHa`wcaHdrip Acp፹pPиmIpascR`cernªثQmptoqꪈrfcis-wr(8ilphb:tor?">Aʾ! va(ݮpokenxXa foo(C)8needbadhbezYtPwohwitqHemo,a0yleepzhads1rockTomZJerowatch.bIo'cl؂:no غmвuraJI򰈆‡lit0alqhнengxdrhaulrif؊JѼIi iHHreОȝhi3YgY󻹝1HglfrIȹYvagexpXyxڶpd>viive-l)fep-crxnd,sPamass ΀theeld,omef marryingnirandsbjectshichelieveo@beeeayfrabs,oughiscannoturcausHheyesoarway.Ԁnoongeror1hastutalkeduietly,ithcontedᆈXmhfillp*aen(0dutyone.ppearKanekearchtowar8hozyplBndalubyaisushow thatopini@wasman9gre8positQdignituformYArou`,rompseeaddres.hڍ肊open0oagain it@ftaIlIservɆahalit, ,qfwQfuel dotn1ɉB1savageؑla񕟕tookЕOM.

"̕cdeviЄ[ hcrificiBaas,"AHanOOHAhnAt(b`occas0#a pful4"`ɞX"or,)xworshi@rsG."AӊH@riڛTsQ@PtlcompleРI_staryXQMleav:st(rnlmoshoooppiR!alar:yiY:amp1so舂CdPewPyy闈fuddbroinةY+(DdIadvan,J𞽛@Pai@𯂫(ewelTdepѝ2runКS@rdgEryleiǞdrivt,soLs.ew )(d@Qlengpslhpsnc؜ZisY釨thrdiїzeϠ>اyCگwhoK?`ѦmatQp;`,HimqtX my`paRsgam)na:hcnpisodahO"ouldӹᓚt*ircum4Z@o{rar0abYtwlef9sIe5foldyrmм`b~*ruؐg0XC0blaXupқ80exMipikHBrfixXles.lЈejea(cb(wrd,aɵww>"Hu`!said. "Ws`8w?ĩJhschief?>"Ohf][ "T9HremembZ֪(umipor049en.ubtpawiz뫁a#,miɽ2"e0qmud;썀daEv轩.ӳ,min inkP(sjapmbuhoxnsww">M ȼypicksluKm$0ȋPw_YZ'"YrJ roe"I 3Ѣ͗إ|q1a ^뭀;¯ffnt">tudi{)2clusio8ToAcjuonly󪱊ɛescuNAqolrown\nckndea1kHha!muZwox:curlȧdenЖpPhdupx.ƱmagnifichPbuilQlarHey0 unw;ell-cfuӽ@eX .oruq.ypۍ m1lo"@nYy`nciiunmbl>CzwoXh5 Ӏpeoplesanekeimself?o;lthoughoi,teemedmpossible,orowouldheyaveotere?

VeryuietlyndHlemnhenpproachptoQsitting(ton(walkisoddounJnatuHofBgrouallow,K\deccuhdiscipсlayirighsp8hearts,owmeourAfashizatRalmosturopean;ylpndeed,sIelt؆stupaofft{re8„q.oanyd@hutH(regardHXthmicurioP`huntersHer+se spa rd2w8Rm0gu kni xipologyaid:"LMacumazahn,oustillHr-imim+%mlead)(p.rqo r[iХmuchHshpآncerdayi m曈h8ЗA.Ӈ, ldmiaghHllЦomJmm@u kRdep@ғ¬nQn8;2Arabs=ru nbur2qbecauHrefXeliY1ӪbEs`dohrlessёɤatPayagainxX" poృxmpans"2thnP*aoL`ay;P raPr+s.϶ip8qu𯃝8 A1e|"0vs .hIs8e?"GG"Oh,ert"@YIdjinw "9PҀalso.УHI8fڜPؤɥ`CciA)Usthite-Mo8manspBifl{Ұ1to)aw - O>"T8 ҩHrrrupQ owh(LckalmorAialWW>"S_Xre"d¾HAAd2蠓black )y ,eroHoS@Q}wU!(xt.jne "9liaxurprx. "WelʹIuxRabouUceؤ碁y*H,HpalmyopȶapȕxKarrangeǚХ:Zfoll⿐Q[8self)toppںHhoɶ>;giv3xJt9rغ3shpobeyeTcȽh)9fGs:gipRgg">N)emZ~hiu3urin8Õrpas9betwqaP?) xrremark"ۣZ t(g?>"Yexal`f ym*8ic I˽+agexyZelpbr"p BjasflWع7tradictSg sڿospoIrdsK9ainuteindignant'mpuHIheemrX,qnAfriس1rppuppQQuXi`{iY\HEkoc)IӀasboutoefuseuchositionithhereatestmphasishenddenlytccurredymeahereQnoiidoqu8.

Althoughadevtravell),heardrom(iendsoweoplquringnZEa8plac!emselveschargefdragoman,ps(ndid`obsequioudividualhoy-nurshayight@rranges,omdPfee9mersifficulti9wl،*extorIorAtruc1istYfinalpgentleaQhloy!whQheyouldoBbackgain.t erd,Po(ԑkirAprofessponraapRmeltw茁iml؏Aoublv irNdf@ls`bЄinvariab.ƊyymtrawA"ncYhimuHb d>StQHabe)nex3condxlikook'Ysthxun蛱arxAca,B)ms@qgeanymTܝIemip1acce1offer,le0ifzwor`caAccalHa`硊obv2BIompKane8Hru0kᘸAng@appen(+oȟAfollowChȊ(ةqnoro espiة˩expedmi w8!H??>Soansmildly:"A .ouhBZI30"BaasHsaH@n4`ХadvB2!getolsliv `wmmy\8yeaowJHo1:adt.Ȟ@,IXPxon't߮'">anɬIy㸢PyyI(un:=✀8birdynat !Lno#magichechhimew@usupitudeci*0beliqpid roymutifu ,hite-M(ߺ/">Wx¸Ȓ i@wak60jneh0nor'-wx.ŤJprɥxloa@Hor) amoPnd1fto@brkittt)ieo@pon0XHI,dbacZDajmfپT1Jerllly.װedptu𷊟rBùirae*throw9charpdQubPus;sawArab`zPvag'T"frie@"ѰrhjHlk0!¹ϗ 걨qbe(XEnglish`a鬚ham C#*p28x0t>SyAmarIek ۠9ypi9sت8bNhePDx0Arek;leasut%PTll9Zut XfrevildifficulH8Aľ countZpass

Oneingoted:patlookedn텨awe.tirstpsownQ)fac 0mo0of mevereforeeen1lhitean,⅘byegreescaconcluFPwmbe`(n(Z`oxs`xaXȇregardH@apowerfuletish,؅xk god.hwoul(basemselvupjeirц)makeHferXpow`graizfruits>Whifin獔I8ok1ice;wh0villaghief,otalkXlitt(Arabic,vmix0lave-raders y0 broughtscocXcee`cproHAspkmye1bPii{drawl.natPIdirdoh[rewIaBas9him80eZd errifians,maginSXݕjecX@cau angrYww>Pr`ntly`(ell;Yknmumbl+eP%tondoonouX "mesger"Z"HIdm09ƝfRP@ t1!meant,lh1(uKanekؘ{try0uwort@avgט饹X2 hriu8ϫ>T٦ross-examڅC֍xul"shruggshYBaii˲ĦxesimIҦؚdoBw.ȔaiXhew>"HoЌPBaas,"R , "a$prepxreceQ+lZait21gifts?Τ"oHwl's" (ftXc' ") "g orw0q@m˓*u,specibni꾀i1iӹxmissN2wpvp;s"epfaA !e0"know?"߿"n'` .?>"Tw[!ᵰwl-pnd(pirh!g."Ȕș{dOrrhaps)ؿstoppsa1lefpip gHḁېsd8ǹ>SɍIys ymhunsoHlir߻">Inᬙ8g`usonaiɵsu0sthaᣋinºQbegaeuɦ1ifuQ;uW\ca#@invariabhdH wPHZʟCgҮ{bhtyԻؿ J8y+qobser*wY anyaPЫSKl@z8QwpmoHprop!usaؔrX!uelѱ:si(fBڷint;ʻ`3accidzlqHsnab12jth.t9Runnatur`ffaigupPnЧ7Koƽp!!alweepclbecod_o(sexIsyȬ8Hgl| 7Sug81lilo Ѝ"b(ࡘ(@s;k@y+IYdreamr'ʘexڱhlittdaag,:ୠйٯbHepaipy!marзu`hlegma0и""MoQ 2mȍZ[0{iPtphٺ3lѧP98oɳX0 𵈃au.¥pp訐akprӀoadorureturn`ney."

"WhenemPshalleedoap,"aidomnollowoice. "Weav(earr8Hanshat(eady awitchWhite-Mouseissafetyndooztuneoim,ʀ`you,ord,utteemaboushnothing77>"Lookre`IrokeX,xasperate8"ifwarhoightenщcaIXnтacepevery esh,*hHbetterzQmplefpers @firstmp3rupway.wigi8iflIasHnyrtridgsjwantlHYdonkeyonnary)m)dreasohyshoul2etackcoalycimopockets">9xisremarkytbabyrburdacoIday'sԚJe,shlegmatic,wPlualithapenglishlX,xiIur蜘Ivein8ifesitself."LiLittHoP@u`pIfgo `li0mMacumazah8!l0nidXiފstxyPp*{Kanepeo. HunxtqI;zplar8rY8endonxdincPbe3ؠAChridљ0cows?ٖnm魒Is)d98P@iʠHms*zk af!I` rIy.xasid8ӂkbuil)( cbtqZ bgg>"TrrepliX9iP "Iаwaccurwiz@oيsppgaH赠y°,quxppB(`gu,Gs2nk@inxtostǽ">Hchaиp=cêpnd1ppntٳy-larg yfixupusZffec(`wo9fulB8iY1yKwPb0 )ɢnhd0pzeѐhun{afrIHsomeZpo(7he8Fȯ𤀶a)iHacehW"دnslHly"YBuexAmpNext"puӀtskirtsfhisorestywhichanekeadpoken.taserytrangelace,ifferentromnytheratɂHveeBntrew)an(olemnreeaecih ntoe;ugclean-oiledwith fy`pmetgerhu` un,LeySickцie twilightven idday,orouldundergrowibenphm.ƒdidowryJ, )$JidepspsnӁsomeknown (so refusyolourish.hesRAtimsu mcrosp:co(scantyusgrasses.

Allnweardleph8rumpXngro `norncafa d3em ZpauartxڇЈp 󏪂[ipoexcitHprofessionalscTderrHwhoҔ‚gloom,0ayxoll9I(bjec -g`nl(ieilAڈ@wbeiculYebivory.,owHXAtalk8eclaIoed02cglxSȆюa wHxaHselvmhun>gwbeBnxiouoYrᔨ@C's bme-9suppolexi0t.lIdesiwoshfibȎPoKta t8٪heerfulHannel.ЍltoIe1˃̍AځذRco!umarcunXkbxhnt??>Saf maQPpreparat*zKsY,EHaQItdԘìc`ؤ)ge-birifl`ooHxhtridg`r٧ѝùJ Kǭ< ɓppPKcribHdh| db ao!pIw1G ȥhdep襔.׼on!HpzHteadis@p03YticۣD-seem4aаPro ټbetweqr0ckRaajliH;K`t¸$*>MnȡXpurПidli8my@faw@Had ؋AlȾg`u(oacowPunseloGrppapuPhaaga37lȿsud"ɖpH\mxpAmuj1ʯ9% bоqveȣBtHco༠)sّ@g(n(p`h@flat;dI8poQR@bott"lH>NchoasȡĴ{ș12,I(yu#piciFɥhembl*ytumulinrtqHHEurwi ӛry8gQnefs.ϘpBҥdis4,Hbabnaalnd 2-8Y`wxfet0h"pl:1$تڙXowem`wI`c`ywɜXrmJٻ>Tt̮0@!{ ƫhgJqire@wor،b ypLoomydepsHav)clim@hlosidQ Ixcep{Q fH觢Xhaph!9huciprimevinhabitẸhZinu,=eӀastistoryfhelace,asxat bottom+isepressionayoolwateruppliedyomepring,rrainhadallenecently.

SeehicheeedXwhozdrunk urwn,ɅminwouldI0ight )mound,(thoughhcarefulearfritXop@ilohownignelephanhbesȈه>"Yes,aas,"aidanwhIavXrderH"butlJsam@on'tikeۏ (dqRЍ؅getackYfo`Pfم<fidr1les."''Inquirb??}know.erhap3ykscos(oncevxhere aboHcaQseIem.re`aB`yXOwl-maKanekseusl+?Ǖ>"TԚJer`9i)?">HeH9ѐhwd:"esoٟ0fows.0Tbe؞Xi8<lipnlyamwAone.omu(bhea𢢓Hswpo!hisomakypcniHbeYlectY:rщiIdes2Pcupab08unHy8idypushЪin`itWoȤnwɅithnvict. "Tr?hgiciaТ4Or鲺mXYPreyX!ypspLx+uаyou@@">N@I1)TtiYѬhfoح firmn''>"S1talkYnon`sX"'0'mat  sagoqsof`coв!tǥ?׹ sleeptoyreturomorr@,campǾ0fRDb<. Œaoo˹g "WPh1Pbolدtۼ,Iwray(cbhim>u0Y tbigo1.atoXus;cyneedپQlnPind Ishsasu(aYݦ:aanxodvertisemୃ8 )(lگ8tГЕJid+ opspac2AbeCuw ls R19鼟jlaV!tx-dormbRzropp0offHextraordinariquiAplаI.Χaxci-bicri;Pr9}de(8msilen{Ʌ(0sjqofwelIɩamiliar8!ostb'ྨXe/>SffII*unHjudg˘|towardϾ裚XwnЂЩɇAe@atbigo!!tolybدȖ xYؿavorisk"blذ,teUhoA:ȟarkabRref(`hr@ktus؏n.hugeesawJana self䘪bema@8! 9wțjtpe;!Ibetwqa-legwhp engagX niff $baAytipa2ch٭Zactuا:q>Ӏ Talkfightmare,rt-elephanttheattethat,evxdidnowoneoucht.fourse(thouhasdream;particularlyivordxarisingromndigestediltongsometh1erButZ"notkeanyeq,alۆHhadkenvongoway, yece(>oes.oreo,fe؇,!hideoustabbYpain myeg? (Afwardisexpl@ed:antryYaretallP'(nthimself↸r inxH9po"wait-a-bit"rniБpo`up(rs.)lso*`possiblȍaؐanV)ll8h`bacj膐nep[tdustsdgrassсostrilsnduca xrdesiؖsneeze?

Whi(Iؕ苅qu9perfec0go@ЁbXIa0mJictux waagigic8ac0inviga0s([epPgplsXwўxwhT1Jylaitx8nce.h؟whieJasleepdoAhapp[Qfimm=proasia@Sb ʦyܦstell.ԒsniffedPirAtNht;jappvysa0 p锩trunkizonex<ЖHasyoflu0a‡۞JolْrIdvoida򨲭likodȮ9lAcrUc0epZlmohsvanished.WIntI`up,oxearh8H؉H9藩S 9g۩gKspeaRҌxdwslopiav:drPkQaldad.Bm,ɮƛdl}BAquith(˳(0mQihurrQshЧA@bottlg{upbiyXricira b urfac 77A0rP¼ٲrpi¼occurreX,nbPma@Xɵ@a if saw:qꞸYw0p`gRviexcepB8 bb󹈣j%umbroxysXf(ߵ>Xxǽcu1r`adpiXkqh9xٮJshI(rawlĥiHv*n;bbrokeemergwQ B-9sesTlea-rec`byWQby\ cay9vyflIedg6pXШ__>r9ɇ1moonlshmPYtyarstoonor(uZ`moh platxmjec1J*itremQaos m 4con iA*Qh-Xet.eXo1Qtвign="cqr"> +2"lor="blackHb>N9XpgehmazAsHphѼ iha8пIacid"wor8!IYllHMrP+ȖCXlunAsilhp)90e8lmud,,ubX믠gic ș༬ѾxBsրeeyariousigns,tandingotionless n8ttitudehichaveၠrangemprfelancholyupsightossged(who,evisitQtheomehisouth,indstdesola.

"Baas,"sper8Haa"ifihif9littlereoleЁ!{getmehear shoodead."OO"Ion'tantIpliedȋfipIllreakreck/w">Inow,ouII؍t wer(causyprPwshakeadf茨( uldung0job.u(ttfact,قnoQsort.orPunexplainshJqo`h1commHurdrthatleph,hadusp*0lifцIa0tPercyϑ>LowYwpokesupIbumIBhds.nyatЏpur! lo⎙dPcraWSbli Iafall.ɋ,wever؊!apntssfelaБParmY,ncfein`contemHlasكatwo nutes>TAsudden8trunkec crHo jpi[(zPmpeThriТx0eh,Yti8 e0esile9nRbr0na XrifyYponserom 9y 2urrourd8rkM:quniHH sg`ȜyseemedOO>"Allemag8! @*o0К(okh @seSfrioq)L菀,ǯWeeLX ?Qasfd: "IAhDcd`mAity㤀ce;tYh@p,8toprar01unloh8irf, o̱'o(epw(Led8HAdrippQTaJyput*upudibajxtrIy$8orhwatcawmomalpPp ecAZrr㓲I@aQ tngȃjn1oѵYank0threeѦJĹfriuphobrʀHfjIaԿQal(I zeXcao*ÕؽoppaBJwi9witegu`d]1k3h__>PerhapsdouP. ne`a0HHچt imnumb0,p`werl*0Psʮbm[2GecllmQatroybull(sWs@z(tuskJJcow(XꨃsidJڿ1lf-growzxorɰcc bʂze>SoanekѓlaȸJelㄺdop@wP.ϫQhHeaven'sdidq`x9bzt?ƾaew`mbegainаe0iRbev@ж!besȢ¹iciwho {ɸ@*8ۇ(morpiec8HmpldeawpIg!댤impih@+iwon:pectacاdarriȮrgeHamr,`ep,u@ptoo)0(7⧂(6Xignay0eltwn.ٻhT tkЪYpajᚘIcG>""do̴,aas,"PIyrux+b">Tۀheiantullrumpetednce,shoughncknowledgmeofealute.ԂPherdsosndreollowaarvepuserforma@ atightaveeenak0 dream#AsHss0mselve@ogeQsquadronsit@chargpastmouPfromtoeft,mingCey.ftXameegiscowHlplyasepargrowny/;vQ(littlajsetpierceals2yH-ed,totIЍF:fac%stIgaXid ,owifHintricatIHuldBc&une`hilHsee bXwhichal1єH Qfe, maywZowab&aeaDitji@runkPerhapsoЈMcXmonybetrhal,do.

ItaquddenXhadun8firs9wheeP2chff9hreeivisiHيJ m Soo8@:gonexcepSo g-Y,pth0oodiljubeumajAlin`sonifix"Doouinksipqe@Baas?"sЧHan"Becauif , yzbiQhoHhimsÈa."WWh4,"d; "yHdtن؂/">YmyeXsupbњfoolnYalhus>"Jhqna8oarx, "Iqgp; 0idn'tme(T?sՋcɋx. yookxAl?rʌy/">A10oqhorro &urn,whstraBH@;Cwishd madے,dunloxifдkeepطfemptatR;ԜuafHȜ,XmplXxaia;ahh@iediey"zd:I tYray`aver.µ,tip9againmidd0$0h0aokneap馁fXfumccompan0s"⾁ҪR xblewawaYdislop)recum0rmfoxJerryWW>TdC؈)3mo:)acroпyP8icʾXte(solituѭrv@Q4rka0b޷GG>Wܹlo*щkpYdrank,ðpirhdugdr(upI`2rethH aapSedg 5>XdeadP"yi2woTSa8n PphahHbl)(idȩἑ; x0gfAbȵNo1scu(QwMaazahއwdFȤfbeAciul ?>"i2amapɡ؃`;cQHtpf,elXXmak!Hػ@0gurg9شмПyoridiculoؾ2aXc82ܕcCmQyIhrlaireliev[(ves˱8g(纉8iphopthoPE2lBm(o0co+hol!caʴڹx:IXsim艂any+th׿>"LA0и0eW1zdo?G,@sk(onh"#3sÞn0HQviاhaѴ.ٵhriJxrenAisutisanۀvilpirit."

"Littleolessuiteight,"rokenerry. "Iftadeennlephant,wouldveilleds,utxingYthrew0(topeaterwwpFool!"runtHanrubbhmiddle, "doouabetЅt?nruth,sZBaHknow(bull)neiPr;aahiefrXkAwhonceiv(tplaan8nd turnZ8)athoseɋasts9m:diIte[souchfraid,erReopAلala}s.haclea#ɅmamHChristi2{f.t,grehjeonwPl:hazԎ">ThP(yrang o)tired.hbyfinishI:oo"H!topdawn0eakDimbXkeehatch.amːmosl@xQXi*Ύombackgg">SolayopȖt`yzehic[I ke n!I h tipafexperiePaatal胸ndoؖtroubo happp:eu`BcauImu0lwo؂Jefo8xx/)2ާ!YcҜ!help(;an(Igeorest."dm8ړwWAԧAaҕХ؟N,rk wț:decentlskgar dyhRvariocolourBoucovPdhu/ѣc)d4woodxjieiĔﳈsurCshP#ϑ0@f2ЩS,aonta1twInҫZengagfз𙚻`r*ɇ Ptodam2Q@@Y[I !p@0*1roupporсcarpoQkR'e hXu8w ټup'@rememb*ei!plseetQкlargic9 loakcapxdfe꿄ItihQذfrafax xskivo"a9wpru%d2һ8amblBup2imqh bjecXaudoȟ`Zo0X.࿀xpPqumBP deb !t b;ansɐȬLpligh">Of9rJ[ҿno bormag-mbe (vtqZpnQt\it.ӿQ,fiweenoughWsI*ImyHcyndYIinclirlie- qr{nci0 p }CIٳJϾ@isl@inhabiaHvaldX؞2ord"safpAjttZ m@>H0,(Peljaepun fa铰r1b:inkseyire*Z9nepnțearHnyh'">"et'sPpf`m@bekc b,"°@erqyOO>SoIoo`J tdc*always!susuPb@ ر;l(pDXhax#y0llYhW۝ lhifaquhrrtPqJSlthsHn(l*9qbott c_enacaᘚfewꃌȞ(1*mempʞ/~1victim pisnIucKaneketaasۀohereaterdsflephantshichameXge`rnisistrict.

Whenentered2forest,owever,uroodpged,boutplacethpendlessireessheighpfsun,r8asnir!gloommostepsing.φmarchin\thsQllowP2owrailackwaHkIadepcarefulktrunkaze(re,҉IndashiopsxZmakeYuponreturn.ooseneselfouldeHb䐀dafate. mY0mpR(l8rpo ӁۅsP8viouay,observHan@granxqkkxancr sher>"W(mat(?"hasked>"IBa8willokzǀsee;i@unAveHco`dBwpeam`a8s,"repliweakoice>Id:(aun0daht薩betwtwH-RexactlyJ,qfri(k0-^!//ltIonf혰mx`mynyPwJ>"PerhapsponHaadowf8yIaiWߐOhp,R.t'smenoughfel𨪣xmaЪڦapf-mh,yn(dȬQ.t,youbtp4Нli`goS"AĊ,mrJerrwhoah(,earaupan0nЫy2caجh?;Ȋ+ lefX[luyҍ, "you bo0rYps alwayahm@plea٤oҷaf9appxtp ySeemyorn!xaialplt8ghsȚbmsgg>yxw plIqi Bc`e;f9yhorribenaxIy.ȾIullӷgeYspoBsel pordv׮w"e떁HiexmitX&hmadagrxhumȱ>"Ac,sx ٟradPisn't?protecXRlitty owNxdo ѸHauYlizʽ0w peck*hgؗcxڐ.H𿀀꠹ Jh`eey$yk2waт¢gaiojky@nz:g↉ax2>SH h ȭrPydriveȘ8t߻>"ConΤkeep?IbHRmb:fٝfirunl\`ubchargQbaYQme8dПҵuNfI/obeyed;é0XommjclڀRhenaǴbarत@fCichobser1f0譨ka2GIؑ8,absoluturr`dhby.ԟ$sagtؗ1➀unnub)Pa묹@denIX|ǝufp!s@2o`18vaoHPrdesuickpossC1noubسyaoccas"/ms8t`oi(t觘ni0;pass 0iryf.ͺ@0Ҩ)ȧȸ vals(yoilctْyYo5؆an>BeaQ/H(h bPٓigCYmarch8afOis ۀthereouldeouestion,orhene9rossingnef pgladesatave cribed,lookeackndaw@normousumberm,undredseemto,tretchAalopinolemHpurposefulroceon.etright2lef moXahead.tas thoughXlelephantsCentralfrica+gad8!

Well,tsss(oxntinue KpbecaHYdoonlysaysamrvKgaipFrwP,iHgotear*camp@ndetowarwhichHvxmufast4it.ȁJn钱frenIqnt`Zbyilknewcllȓ]rabouilIomboma, perhap`ittA.u˜wɇsgasp@:GG"Lorɓabegțun."??I ifiatj;truTxk-bu!breaaignDrot,ȑsubjecZfollowaexlN5P,ن ` o.WWOhQ!eldhzIstiؤ@c2hy -di( ra0schoo`ўсoIseptwithx)閃.׋ yè"fɦtAbסЏKgr8XhbepioɨfootfyiquitDXpzjbe(`͑s|rȯpgQXt-hz89f,1spicu 2h1ro9Kanekabhase'w>SuddeQGAcAЯ hiXs٩mwfiAy`stopdur(sBmelawrpths]K;GgowȻlleus7gg"YPIlaȊܵ"replh. "Asknow)zl;̀)W@!(wџSҒbh."hnv8Hتӻqtٮreco:comuooTwɞelfownhlittllcanvq@er-bصXchit⧘sibl+arr uQva[exiy񺊍rivalկ0)(fA͟aslowly8iJer8ڞecKragHookqirsXrifQ.RzsrPRdrShXylife (bԺѴXdunhuraoge,:)t`klike0=doZcoh mer'(yegaȼexIQcyasѾhrangJvis W>LhHan(HEҽ-)ۀ,hoquattednheround begao8himselfithhsat.

"Why everybodyoxgryme,ans?"aidaneke__>"Ion'tnow,"swer`, "buterhapsfouaveropofatottleichbkeep herrlanketigh8bremembHeXonBaas˄whenZhadtooche."entnp1sheltmad@fughsre lept,2returningalaskre-facin,0Patifoi9aannikY3 gulpdown''>"Now8am!i7rXڎ;licedgbmptyin. "They hO,,`caushinkKplaygrehtrpmZbe1azard,clHpooksserapesehantsZzmhuhu,la07YʆZelsor™G䒸dignhly`AmoInP(?_>"OhcertainlРpkayyP{.oriexdo@beli@pywstory٘thosil@ers. yfpʔ8`(ophnexXiseȋ,GՊH(llppeܓgwȚ(0shSK'tIoearnPrV':aullet0AP f,xzt J`gi`baX̥awDmur0d*)goТ">Pn򍹲Asnats4̯XuspdܙYXc0kȯHhiminixwȶac2virtu">S!Z0ݞm-ɣhy*B{dBrįum6strheun!tfuln1qmoraaHTomJeralsxlespeЌRimy.ÝqfirZchyؚٞ@(qexienc|mee-`/thYafwJq)ouB ecoXcoulq±xZ,lefrfryedQkclafrپOOA)circumstaڶlbusinunuȨӰpsebeS 9e rcbeaswbeyɎ''>WhoA-xruXwkܻo ? Atmw9mp۾XfashioyXwAdoXAuhharm?`}0duc`sawgicworkjscOgr0snonеfrmເIewbhelpmembz ccid!prolo0d!u8iJ咨m m8rialize.op蹁xiquha䩨m.hu)ͳncaes Iialn0Ynpart.ϥaPиP[@& "Ay0 ds?مQ,aneke?"xasked>"Certainp,ord,"aanswer "HoweverruelyoureakQrargm!afttakingy@" (hywalludtocaspivory@ich,ikPol,hadccepted), "IhbepenoughliftYst av(Ԏ`beliriskownlt(truno3run.""WdoJ? kn`)zTsqIɂ"i.ven"piB torous uite fYǕIArab@ttacҏlepts!UiُeXdturif`keepmises.orJvpjtbeginn0gYe,ynhappom2om1eemoreߜohTRa(naytprest irreng)prembehim.utur苰fx[sio`syeiAdepart. tribes hhlcom upoutwardnepњRiᚥre,8㨨Hy]z`b)rNslook#Qsea4_at'sleash!yexclaix,ntroll temps0(IlListen.ᦀl:Й0oooaPJiXTb=ZyvX@,koisH acMОXexدxytisfyurioPdp@neQ@Wت㶈Mnd;lo sirlL٧G*u@gIkȀ,ɹjq (Hdrawsoth.ɓ]orlXxsralv0sjsecanZGzry[ˤm!do, lʒtalkȗp(DmH n.Ӈ؃ӍAowlausiblsmo8-tuɑbAarٛdeceitГ0noRosnؘngoodlign="cer">EXPLANATIONS߂+2"lor="blb>Nextn!8IBxJmatbeaom2Jerry`*heP(adepyXXg蝫`th ʙacЉhs0Hsr:ĮrursIfHӰ1eishurn,Igx{rifliaira1ammulૉdonkDonna ta(QcponpctPX"deؙpPA9fkIr01o)Belepxthex@i䦡0bec`exhpgC 3itccepta8//>TqulZog"Na),irupbж2npidly7>"a8mΗLjټ$9ehrist@bu&xgqselvhpe+lp_YanUArмؔ 8crim*a3.Ƃ@sϱexiwipȺыpvagçppropQredeemhonshiocho"ifؽ1Ydi 71ooȲizh(Rm .fquep޴de 2)iYs U9cau0pg_wH(l- ހouruns,ithhichtas dutyoefendou,HrememberXnly twoaPfulervantsonewowigiveheirXoaatfmaster."

Isotonished thilemnpeehIeganQwondwherom,nrPcon imselfohelXuponsPn,brea "hun'saw"pheallit,adotymyc8tockspirits."Wdo9y?"asked,ookingrRJerry7>"Oh,acumazahn,"swerphlegmaticerson, "IyLittH(s pquiteight.׎halwaypaodameQwPsboutAtol*proubXcs`urؑbepwatch-dogXbhjackals.eXreellowhdang`thr9a*rifh`8uHkepo"lqprotecy(hlBpaid.ԓe8Pill:gЛ(ltgzbelieqalk eatheua.oڂЕop1Jb䛘yearc l Ѝ˔gs;iifǏPPue퇸bull-buffaloi??Strubb@!exclaimed. "YkreXgrast0I!yt쏑ѥkgpt-h(tIВИI՚ئ蘙hoshleph˛DheeHO`bmЖ[ftpYpnHsPءywi#trretuXnxIP񪪙sX҆`nronŸwo0(becausΫhnizR:,anebet@aXiAJnemyo(pr0\cXrommidpa9o(u)tHChriРmmkbz 񓋤ఙy(egJoemhI Ayry1(ؾZɽcseB׺>AfPws `yiplo"ȇ‘gȹؚPsر]oZ wI0p{s fr8'ϵBaaso)!it8pea: pPwe bٱhaXngup30e྘aside" pmeZnar*truth" $`H˭Qush* "daHrtspypa ign8l߂)ɋR'ptF)A82,mux:`AЄ .׼@:kѲubt̅HJerqqur!;abeche`Owl-m@ fّnhpYei=rPH r2i.¸~XJgi`dn'hazJʽj0SmselveS0(sdeڮXplacFirhapp9qin80hashap)fuwhy}leždotr9BPmarᒪficulaeKanekgu01)1faiaaHgo1dthghvarieAfrnrIdriA @ toeepȹyicroPjXrafуa noes,orhenanekeadpoktoheirhief`allativesecameostelpful.nneccasion,tsrueHhere)no], 8suchq0boatsraftw obligedQswimhi Iidithem(ng,p8fraofrocodiles.owever,υfeny,olitelyefts,yat!usual1oaf.

Aftpass lasehru)rahrougxen 8e0qtwoayXyernooȆrecond)zgrewinnxa`leng0chanDalairiarrlw8c،2smimb!bush-veldnhort.h cؑ(int(hot(illegf yiIndڐs9disfromumexȎnfhtse-fldpq.J,xcepdpirritLarm oЊіԇsP(cattlyno`l Cup(`e@sbel0donkeyXimmum8buckpoison,Tpr3Hbea )ny#ɚDonnaCIBridooeuYhemadlhQlaboriu>OXAIyicb s2emsudxxhavrownak2stuIopequentqZsmoud.ҋa)8meigh`en"Iout H@l!nffecYbe9wouPfollowIHan)h誀,hog.׮ypnٔrseizuastaggerǥ>A nIuimuxmer.robabɳbeAcAa glIi`o:۲؝-haڤ ais2pbypе#oPlop (Bhh  ÷vm9nantidotSo1ldˠ0Yleep>.ɮ;midd$#awafe@@somepxқHI0irfrin"5ئҼ , pilۯ}popS a4w3 rnbuilüyftla("op`1yd 9npYɡ)@asj轹HH>OfXu(pHdoTlehQ1$)2or@_Ad(kPriCgXqmpefxt*^?Sb мSminut`ʥAAsyfIipres r!zPA񱠿c ccdesig0knecdȲ>Ito8e ȗdetail@gx#ټи(BXdӲsbp#yg,¸toucӈٍLܶRzimcr@ureiҪClif`8meѮxlxcrXh8 a capʹmx;藢 c!Y@e؆eЋI)ǿ>"p*qIbackq\3lIHbeڜZªrdabln .ҲXI𭀕Ls*ͪP9ҥ`awc?^mpSseema Ihard-`r,h󝠆)blubbworditki's Ó9uۿ~Hy`91cx0sun8">"Baas,"sai2heerfuloic"^gooew mxhse-fli*finiЫ.""Wht.?"УO_Oh, Owl-,aneksay2qn@ѷɭ71BclimH.Ȧn)dh atehouldaveoyoter(e,re逢oeatenyions,hichGbeaity.lseasrowingakndeallyoferttlesImladQisead, nowsh8s@Qhroub@feed."

"Ye@Hap"nsw"aw(yourhhIookoȃfenceust9lightganglintpopspearKaneke'sortersOO">AtYutowScof8hur@depaxYpPenthmuxamfimself,caPaidfp(h oQimtory,Ad8nlikspi8:RmaI@upsemadbe"*aool.ʔadhunKressincidP,yd icularfDonnah{򓚓ou@uckBchangpt"ng:on"o(avtas`@Pflesh lo2`men.ggTa"r.τ߄. 8(cXpo]r!eHcefulrogO>A`ways0rc@moaiȠatip𣑒Qs`Idistall ڢɌ)fa@nderQyriouslu}ᛁerRugaͅ-,beliecpIxquitQȣꨙob@s9alivheischiŒoȖciusiniɇAi[prhbclimbm.ycercero(i9rs8circumvQ@вcramupʂ)*impossio>How*ԇptPgh)1xisnomer hwKRٶ`man.Ɯr@fZ)repshbĄpbiffalw1(lengfin*s0xa`㐣flanks@turnYSojonnxhHtQpjR8hce[al_`q8H`xrc׺7dch\summx#GIIYY2ta-toppmmAfricHmat. (Wd8?.׽IthorXffpirremo@era%worldh`;sa`dQmH ago?)ۥI|moreci@sa@;Scot8ښ@og"Ccl"soxtyhbo`tO,HQobscuy>Next1ne 3daPHao ˉҽᥜwisʡXkmeq"gruAI aezNrȺotP-skkaI8#;cork tt)JyH88ѭKbi,soȍ1!hHtse-low8dTsptonhȻɾRdg).ȜHiYepЖаnfashR`:"LoryouQ2slJmidۿXlJr+htq@autibr!n1KlaPIIodP @pl8HB8ȺcءylIanɲh(pobihiddXfrom"__"Dx?"(exclai8. "8oppaгm҄ :shYsoescabCgnaw!pbsYe;XpipŸRQw8qaenarken,")̝c(,Hчwh Ie`;8ntfHYiuLook!Դn@ce.۔xИp?/>IȼIKقsrV+l ra`l:isQfhx uf[ppar cHJsiќH  likelatteneding.rerhapstas sleountain;th(distanceouldoteure.

"See,"entnaneke,ointoisass, "yondernwallfliff XtheomemyoplDabanda, 0AreolyaMone.rom 3plalooksm,utAor8wpeayywift-footmanightunJ!cros fsidрB."lj"Wyit?"pasked. "Aey?w>"Iqnk,orkcup@ moX(thosereovomi)ofireugeatee(can< mbedslopesg dowАe愸stits!whichՓr(dH Lg`Howrx:sdo:know.Йef`aC0k watItpimwouro AislY` c0iˍk#oZar shГߜTaigieHmeaMspnirocku.y!we lso ohNayEpy fivrYenќaXbearms;ʗ.tiaJastrobecauhơӔXson/-Gon/">HHroppavoiHHw8d:"DidP!t1storyMgodden@rsaitxEngoiivin+na୘Sha`OYYo@ImePHagsϫa8Klieذit鈉bpxB acumazahnxsk{>fкHsҴpurphjtruѲ кb:saxab!#waiJtKb`trap.,nssaоZi)ʭmwh(qu{IrpXd϶ #O7Ysecre͸>NIP@uEPd׉-MoCsu[mat"Қ'$ ȥxYs9i羗1&Iaxlnth`ghservan0iy xѾ`o!ٹĦqPshx59utifuespeci`yЃSwh "sexuflo§Ж. R8 `erx8ӛ3fveyʁ'",ZҮ[I ew#selI upHjnebe!su#ydlrewaykissfee#eemromġh ms,rHasidafso timoۑr8y`pre0hmpɴyإٯ,hظۤynؕ)(x)0\0misch8Ы0litHȏɖrɸIQo(ecl(jgqSim;pangXKaneke򈀅YcalumnFmaahysi(ptackۃx.ώxecodHhow fradfiauPgҵtȲ9yڟjlbuwi@o畱kehl񲐸ٹel!diveВpXnvenyۨ:remجIunusu8elucida.ӵpbra8!emp쐘w@G_XI%nwayѼiȾ٩軲Thݴ"op bxigliarco e,ndhat(easIingishsounfterautifulomen,ryqapwhichlwaysndsikeu0dventuresthelephants,nhun;!jd.ute@be.asofstoryrue?"

"YeLord,uchXaveoddeshoqcalledhadowЉ@elienotalon@controlx@giftshe(0s`ra@holitaus@rhildr(mak0mardoqyЍ1Yr2appin9iseYo thougsNIn@e)exceptnct.>"A!o!xaHsHimmortalNbIrowh7lK9itponromeneratiw.ԍ; kypofficfi,iher sڈ/(W9S??8QChiefmiQ DabaxsBd-prHtqrip@gmiP dueimcЖCfa@daPfDTmoQ.Јd#alsoOJmaleΎif ;yr͙rdohsuppos\[|եh7Engoi-to-Qgrowsp,?i-:-wahvanPaHV$!ow8сۤ??8Ixkn餉.ӪHa__Qdrawnԁצ+¦TLake-dwe؎rr@` 0wimnXob0@a GIvirginattPkpois.scYce@fl%loupl.]qdepar)ignewS,eigh2la,;sfohigh- ˝?aoD!"askAhof. "w: ͷ߷߷OhPeQ3`livt.Țȕh|Hod)jXsaY j`r''QWWPTڿr 8xmcho GllypQakonou0t mA4amoh𜹯ushntilc(0hO0a:Zroadoxrk_muwalk`mecauCb1KseizAburXa;AQ, hchMyexcla"stran8Efinx0usq!ww`:i ans8PKane i"XzroDg tȐcؔanyhn鼑lXMo1"STa$varywaypen!X9ZWhiteinfmRccoh,@8  thereatestonourhichanefallneornfoman.tsruehathiesyonde,ut8this,eeingsoor0Lmuxcome?Welso{whonamed჈consecrXspouseengoi dayo,Klookp0no :"

HereɄuldilpemark:"Bsurely,anekyouH(mtorya# نSxhiefArabsnqrwQndesay&agrievhmuwhendied;Inkʉko鏸wivdwelitho؃fenceVelikLord,揈havQ!By:gs?,dp[broughˎwasinXshow wwHmyc?eaIhr, r @Ȑf@aso`kmagiciW*oansealyؚusbїoi Sself,鑸nlpaHasnn ur?Ǘ>"N؝.f񂠈ib,"answdentiasm.ԓia)Zsck,ʁdde4pposBla e!}Qjimavmemprefg')acumazahnkspeakaig(a,9Hogʨzmiѣwi`b0iinsulb phemy`siblH(8h@p!thrbhf d;WW"Yar\eady,ԘuLX۷4yo 'Shiec',Q:)@P$cʄҵPldySIto)mong8sprs affi諳hixXeӶѪQzc@0`Qs(eWǹآݒurpnrwclimba1it?o:ImPrescueӂ!1ArabupgawlephX\~uQmccByei*?echoe"Perhap!tins.eanIphY]Pyploplan0srAbӳ$ʐpXupҲriousus0ssgg`Becauwnvey#XZdo, ϫ˵ۡCya1ma0cA.ļ&IAappoiservQ#ںt oe.lsonowhat(ereillerewarxtweenyeople,iabanda, 0AwhoweHinirouspspoaridefondxmountaȂResireasyavlwaysone0chief`leShad +usringprosperitymisyoua general(aheardHskwithrifl ss,ayو`useB"

"I,"said. "AYw whHIescurom r )؍xafter!HfАGaika.׎@,rhap)€ayn't,Hnceo oimΆ.eanwhi8Inkc`tЍmeny)ngsoHchmtruiI gobkfasood-byp ent0I@peᗨifdislikKanekeXHpositivelyxtes8im.T mIxmixtu8aiaraggpaself-keYsticQmostnaptomp%Ight.ettakQmYbє9seriXXrat"KfulngoiJHson@na),su`a؈iexi.ossibps9i@r<;wpopsoϙign="cer">߂+2"lor="black b>Byven1dwȚ0chpl2ʟ(Hdvalityةit(esolation.Ҕkrisedly,Ҩo1gpy#MlR2їxP uigxrL;is0 ueldo70vegetҲ4al"ȸxcact؀rprickgrowth9pstdpὋm0ves.ӫxwenor cka`mo-YajudgؿCPiquA0mggPihuglah ($yڳ( )tfpчؽ8 fasis8@aJHxO`grblumpxrang9ޝ˗qb09pin-cushxHbig1xevZrpp@x=dYosemfficulqdepOA jpes Я. iad arPqor†pbeautiQ9unnaal-looklohfYAbrihue>An8fػ\򑑑Xmi-erHPbyoutc@cXumnzn0aHst obelisk0otimgenhl(y:Y-ncksKa+.owSc馚IY(ma((ah YgeHgxtI8tiIsee@compp:@`Мft, Xmo{yeaJSlav]exctolictow ))➨d sYbdsg׫`ghcurifТXvê ecoam asywC@rfֱIjglpourЬ:mptybegudirstamu;*`̭awoiü$0@pload¨tddk#Жara, )`iv𩀺!y:bHaxreyne¼Ј5hstPQpAguaRhsurpsKanefolY id inшwhcts body*nCI˴I*arOO>"NIɼ)Z,aas,"aidKm"Ӣ9Hڼɿhhanekeasold@rue,orhough8eyilleverayo,tyevidentha)eseenhonowoade(belongxppeoplal%yrefraidfiattacked.τrwiXounoto9fasr􆠅dernessyrns, lookrighten"

"HXdoouwzaleme?eAlisbehindtone?"sP,utnswerӊZmo`tȀriprehded9,rfo(upon`cactu0adropppLdig.IanyQ2iray.tengthettclearcrubreac𐈑Hwernmohslopehug芀mivountain,ich Pshanxctolcawi`Җ cra䕘tOȖDaba.Ԕ@I0unsetNksglA#&g0~croi(numbؾHbsIsHKevBh!him.ĸAmӢpo)oԤJeQyײcھmi !X3vyf2ammunibecha.ɿ8u( yndaagfuHtrǿONfolH"Ri\Ӷȿঈp!𝙅7>BxtP 6sabAfift*Zl ursurnosixXbe@hi=pB!`7ddek:XhuAt!ncK.ڿ!qềCwojdec1a',1nt v!unhurcnkC1,8>"Myod!ou*Ga."n'becePx ЍeHt0Cnd`aunnJ +yneralngagXP@m!scaߦ߫agtap1fowsIirиK*perOip`loaHٻjbacRڭig0tr-c"Engoi! C"מXeȼۯGG>I Bodɇt)9%rXbolba_դlTnixexcepxdQrxяQY-c`ٻ:!d`n ۾إerxh!yceݴagudxEturjfecig2furiofX-+wyc,,ushUb8liksbHZuluyanxtYms뀀oarkedndnstaneoushattstonish(me,xdidans,hoaid:

"Look @thoseellowBaas.heyrighting,ottrangerbutldnemiesimȁhave(tfrirors're Al,Kke.eistlithageikeorcupine." (Thiquiterue;n's(beardeemXto0n qeyeusuallyleepy,la*fire.)ww"DyouI`PacklQt`e#1missed,8t=a0Ieverhx), "warriorthrewkniftnatchisp;hadriv(8ough?nkKmustAb2w),Da,.""I䒙sayIswer8 "iifuncommonPcrowd;f am8derhaps">nbexptwh mhaorgottinexcHmencrapw𖂁ؐ!ifoum)gnؙ`IjQemptiter-bJerrdivP"ȝsom`"xoroscopaf xput@ɝdryeteco8thע>"H&!חhdeviloean?sXSٓzy>"I$p-. "My蠹c 8rologXcz)bornr8mb8etAȑmeHݑ)apserwzsHbekillbHav(ǭ?ͯXindeed?o0ubjecm9Ӥ9r??>"JohnaurPAr0KmurRoati!hich褸I"dd0r)smiӭvoicD ȷ)negfaint_>Fїa;+0ݟrvm@cȰxtPspiriWh!sE ټck= doffeiexha@)$nnglhqgbir zlNunl)guPx+(n0zea)l|wp"d i.( BuQܮ!LebeoascУؑwA jL1˴:su3n)G>Itruphysii(ar28@teon!hHyx2sx ؼ`limbss8xowhdincb-y1y`b hai$.neglhudowx aaٷ*3ɜɵm, (ꞴsousxXhlسgtu>Iral|(d! otrisoJnoelؿs; pIessrny wxrPY-f1yРxMuohXjtr"pla@rIli`SˍX ھ iqfis fooϽphgЌhrkduurPInyr`ȜY/-uncio("aiurb轁fierchYԺl!RY;upP9>"It'0rٹa"onwo)H9 res 0,ord?ns1ɲ!ڹ1approvXX hopݽdHA1hy,ayIqui†P"BecPijbJubh alwayspesou$!@Xmean?Ͽ/>"OPژӫșwbouҟx¦wBYbodS)Woyself;؄2.t8ouI:"W,r뀀eadhemronglyiftll,oresxive,ndleasenderstthIeanoeepimo.ut(th)alkfrouble?"

"T0,"aidanekpointingPthpearcertainilentmy@layXnd. "I!ereoryMHre?oreover@rned8me؃fromneho0AbaellowseYied,amel whiteHhcʅ@†mcresnmy〹r@ea;@beenrpn wasEfp,hoshkillѐHRyoQtrangofl beyA(:swiffoot,aR,AswhTchdownikeၘrXbucky`lgs,Xfhappeٌxchde`ed.>"YespIeaft Z"0@ourpars elsereCI0nowoext.ɜ!neԐS*or‚encmu`bcompanionWhy,acumazahn?e+senseless.Ϛ(taphJh1鞩@rem!ez, 𤐄en[umpeo1@8ffeXdIhowmco sw">Inbt-miqashtookrrevol١:belHgexaougPoМH5!loa."LQ,qlz"yg.ouveꏓsuggXa񥙄u`urp2郠 `murx8rѕHRũ(LmX"ʥattackAySosavaHSescapers"aO,ItpQo">H suddenر8@ Z ipر)wXchі0eyԧauivoice:,friآ=ŒBaaˆI!pbrokeswؼBen,̢a"ц41t(KToheak^swornyvydhmCpGooN Ҡarmcau qhAA𤈰f?3ssull >"I"&ᢑg3iCc@gr )iI{満twtexfxzI,s})!n؄H`pbr!8e,ާYdsetػtwoimer??km»hOh@on'8K.Ȩѥgottaertlad@xW-MoBIhpufa,isݩ֭:saftjjXney.ąpbxHfqP(yf+wpj 1x/giϸ">Sђ| ز ɮiQ wA!irIw'srghiqd؈ZpѿrdZAbXa/lea)Pdrop+ں "sh@ 0rɰgxpenf9ygHnoo">oɊonc,@marA3 w `rbpЀr d ɱIɣapXaw0m(beyoٯ@#orshipeej۫1orx1fи sorrows'>y-fкnumbalig pil (l0pjusXbonoseG_>"FsixʀYevie׿Ppressp|t8caڬll۫QewdowruEnx>ki0@yet.뀀seidoired,bulletfourseassingveriad.

"Deare!"exclaim"howortunate0atouadepaind.ԃ pistol XmuchighttriggeHnthourerhapstasffectepr0.ell,osw?"oo"Yes,ord,"asahhoaly. "IyEngoiIllo1rmXndwhiman,cauhimoⅨPe waoathRaskbuknx*intesn̍er,amX{henceh,stserv me,Xmuste!,ohpconqume.>"'s.ُp(yrepdheerfAndw aift [.amuro(nouyew-won썀ships ataktCw`i mefcoYleɕY(grwny莐leمȄ AantsQpp)promi hfollmolehn8ynerpI+ shNoeHxsn29acp*oZLake͑ЎxVgooKanekph T@matsti$giP .–(rememb:JpsobeHXhmtȅrick"ojurio 1n!y-ea8haB؀nZf؟IRagreedwpWhumbZHkenQpoisocksHalope2moJaewnd9yahh9 x؅fdi@!Avigorousararabo"s/@ek.yЭxo,"rd@C~Zdranklasso(@#dimpob@"HlGIѮQGo e)depaҧamp鮊̡X:lAfw*t>Ho0xdoubtҬ qЏrhpHxXI liIfx,ba؅rHlud9٩p򻸌aoulYtɌysoep”!Pc輠ȿ8eopls8xmarloaxupsϿꝉ@hH!certahmpP(H؎mص@returhyhʋY’rx__Є):trubXep٢qntion8PÏ*melX𳑰Inesha!Ѐ`qf8к2&2t(@YmuXđSfnح(qammunical`rifamoʐ.ϘHڦ RgleKEɛcf@BښCuIi鐳ggmHowe1t`;sp8ЇYsѩ0Ѱi?Whig! ngl behast8 IyoyX+|cogzsw[s8t󤐗>"Wh˶am?hasn'@P?ǧ1س׽OHKeepe8ittMrrk"Xy." ( naoQ.) "T⅔.yod'8ercyanagix.و8shʠIbadؤ@a.ǷDznodpix`t`cteyjre;osa!ri㼈8 bejnꑟspeaklou0t(gabrX,aHy:??"Queer-asp;8iibŠf-cppl8sxK`o`ch,XIugsHils1Ў YIѼCJohnauruB؃Yuck.ײttipo>OfurI(okyPicٺM9ToSJerryAnd)cl)be`an뀀dhispering,sk@hemowanyartridgesyadirednYcrapnd swb!iruestions`ould,illresentlyewanlighbauIszofȃetur9.

"It郀r1,aas," Qaid. "There'oodpyonder)Owl-Xcamp)bt.Ȃ[water."IookRbottlekxtrkle,Xoeizeagerly. x8uddenHaotruckimheloumsayX@leasancultivdoice:gg"Youirstyir.đkIstwordahАme{I(dealPthe>Toe IsrashZ,XdeeBnobeAdonemadPtakeullIaAgavo!oo JerrxBetweuos8woH0idgoar;0 tpiec!s⊀''!Cywalx?"Б>"RarI'eKPG#sndrel"n'etyotsw weС?>"QC.f8wab+LM)ifc?>Alash1joyassacrossfacwsuvery0ǛCfad: Rفҡ 0pduty )jodanous‹yɠ8plpeo؋"XnI,wiɚ@Pack,or𓩤iHh`rfw箨⇘uchIHbMp">He1Qpadv`ZȟQ!љprxQenca)mګYsuppiArabicӂlawh6gҫ?>"W*nair{0>"AllQum "SeemQmiliar#Bp.h,remembRkLagnabYP?(etѨroductio(nЩЮH g eOd:h냲sh,soAe!5.ow/f2ȹ X¶)ewiaimad4lkoϭ1iansw"鑒begonyaguage2owxexceptȃh,a9 sthmportaXmas"qIpAHontot"n`XDXHdnglOjseegr,Klbadly(or Ⱥabigleanjnҽugh*ick>Wch͢difficuljhdarQ.hiฑhu0rHitjAi@lAlarxenJ`wپPȏX࿱t8dr9ilgػstopaw 2A[thYJar 8⃢֕bupois`hiaypoHPy#Arf8.ƔunxPh޸nPain!k8madcPcoм\obtrYla8iv8[sliltlbuckfleshiun:devSrXsioydePi٤(wYUlmov4Bo03arofoeepG>0Hytؚȼ0qui(louqnZT QckPhwofulxia8ؘir( wanepѦ3uXxfl@ttxdA,xHoiA͎uqe@}>"8wl-Mවשz,aas;A1 r18spaJm뀀yide,ointingohelanetenus. "Heoesatveryight,aas,ndtellsimI`doextay."

"ImladhearH," nswered, "formure؂otnowSweЃGG@Oh,uston"aidȃ`0Ifouly3oenoughalwaysomeuXor;"emarkich0thtntaineddealfruPhilosophy,lQlefquestiXoneouldi(/aitensolved.AftthihavarrangatwunsH;kee@at alhnawasnecessa`weو`cseeslepithzeyppeIayXwnten0LahortrayersashamIofh0dsi oyhooanyPar({,stantXoPprofouslumber_>WeቡPHd҅cyh%sm1i1"rewwardsorn@Y1awakeArkXcrؠQ2?>"BeeoXaaь¡0sprA")pZ/e0NeediYQhasn'hؠAahek.feell:agwOO">Iԗϣ˗sLh ȜakZife'>"YedLfulA"a jch.uck!aodrwth`-m rapIyssuc٬YOx@`Cambridg@p@Lookr`M(Qurm,mbndeɯoH("*Yx:'seikclisXw>"TPJiJїfirms9gП1bi8XbuYManchLon;pimerchPyemsepx !opworl1Wfrica)3.yq؋A0ТxB ckba`owi. s`amyfxma`aanrelpHʵx3studi hs!odubjectha8g؆koػ8.lsfusG1R{;tra@adpbeh ctoh`(8urgeonm0g( IIqX d ifadmkoBw-ofXqlitt@vctichbАФalmo0i(ospital؄"WeftYlegy*wish`Uф jfIabtarqoncdc, 񎼓 (KbsunclHSirhom㾉bark 8ccid~=ggxؾX|PsePI ,un1xplea@3xoohr a8#5;눱uchIptyIaLؗS'cH݃A(y ne ad8YA0(@.ϱ;>2;returڕU'>"Semmi(;v fiY8:spec0pGaQYwdlopp?s]ИprzphysiobserЩ(?imi؞Qqci蘀s꽚ourfin⋧pxup"ParlinuurinptuHihla advKhnitУ4picuZQj cipu9IApe0ɼ1 amoIar geY.""Qui"iaip"8ʾ8йXo))`IougerhapꝸXaoodbe`,hApoeeolf߬P@HMQuXrawaHzamʸ9yabmyp9عȁL@re?w>"Ni뀀nheeast.asornnnglandfoodamily, receiveddXntducationromyr,hoacholalemansomethingsainFor restamobodyno`particuonlunterithkilltisradeQbserv9likeouf kiH oughoneursaqiositsireoɊhnew8sXic@endnooubtutAtopaIoolishness."

"OhЂton't," answer cheerful"th is, (il"ti appoedh'pcroroscopehr3ifqvaPt rick9tewheHyhenNfirmly.ggAtis풐H0rrjrcoffemPKanePnxiouxw houlParctunrisIs danger>Tfollow,consult"s.rklecoatr+aorkackeb(shirt;FIyea析nelabco(fifte@llDurbPiynex9u0,uberovidhim.ucy¢o@-sizsoag(XdraXtɝ!grepframe. }fouthPn0ssaryiѠinXsrifle ۘPr`dges>Evbe'Pta`tgi!IsedaypP"Wt?bsk@ww"U臩q mht itsp,or8mahaPshelamoxpeopDada suaßydaشqAí`Hyn@(htAnd0janc Red-B駡,lef d">Hᜊs@0erxipeakabicrfecoo upRdowreplii xu,<؁@qgelh>Shavswڸʲ8p yfCngubN8pYw>"Di8Z⿢N;inqu{yøht>"Yed; "wdoJ?n@becal(8g9dealasxnfr(atknow.¾@paIytwolxj8fowcomm٩,cr77dbruphqbje𻨚/@ign="cer">ARKLE'STORY+2"lor="bl((b>AiDТlآbetroubl!stiffnúsheelsoYxa蟹ɸytxӰfhirrnaIvigreturCercsndid-YRiI`xcW" 8ٽPe cnfiPtampAnglo-Saxrac">Whis[ntinutory:ȴ0rqsupposCفJo"chduc 8 ȀBAfricaȽoi dtYm,Is@ ,y1wp`d KtaXss#Awi`banybodxႨaffps">gQg郜be(rӒmHu+curi`t3muexcxd7>":goP!nQai"(ughex 󈐛on't8ip8pin`يPiplenxImظy pprotx`8ahIe`fenzatoda(9`s0Vq)yљnjexposedoanyemptations.r.uatermain,annotretenhat(eseerelwaysesisted.willassveryollies,fhichamshamed,th8mark.y#suasჀcommonimpetuousoungen.

"InhortqlivfaspsoJ0uncl(connecmor,p0,i when*beiXnonformpuritanicaltam8bofІbinesietȈaQtinuthirhorldlydvanceȆrquite`opersdaliz)ɋ8trXTsaiIuxchangedelife)Jpp,earrhisOdr@ab8@ng0!Qsh ei "AtengPIaȏrbec8 agaady pbornde0҉@dsombut"o@meanP:souldx8ptd0t`Xo8oBgreatXcË ,0rBsȁz)disc9I@rwardH8l҆)boelsenc2㈸'ePqmut陈veniepJrpNowsgo٣ke(ughhlqghXknewtIrceexp@jxbe0`iYo< y,0YIplnsip{,aHsixyatu钠timѩϩͧ m(wٙlsticsupxinP(dqfromaح is."ǧ"worful1I,"ed; "oXstoХ“les`pi0/*>"PerhapҫQI ayHqueunvab/rh@'sfinit'Qr8Aw🩰 beXWҔau8Bi8obloo qiseтdHl8A_XyHixigh\ @t?G>oohimoubt(l(reHɆhhipr"ژhȹZrobobrȽiȮh:WW"SHd@ؿ acrac@oesn'`t?oc)self[k$0ѳ,]f)CAfrК_Wq?qasYlly. LM؍ϳY"repX"pa(lsTH(hw0gasxCfel`?uliغhsXdow@DowouHurr imsi.vnqpoq madbeguXsಈk,akˠeppen8Ȗuyny-of-voic"1:*mid18i\uifyAIᲈJun1byisqdcpx@n70DssuggeN)pnɾawY쩸r0qghrϩ iر`rsѰemb7TrafalgarquQRorn*f XQ_[@sUy@2В~lf,Ҥ`r`oPѶ yagOO"Quru`b`L[ygnalatxwhoya`etoty3Kow(nyuou9spmpyfie;I*rqrx"oAalkZpϏˡkqquiHne)_elsCoXl_rb@Bfros迹ڲbbeautiÛ) sawesoXh!xwpr0tPohie dala1Presai`"woQdra\tȦY(lid)j) towilopng,!(tAhoadv ,󀀄ndawhat(isomanasoung"veryeautiful,itharge,enderyes.

"Shetopped 0ositeoconsiiHahangeameface thoughftlosearch@had慸dwhist.ookip,tooemhave ihelPurms,pok;istinctlyhd*wordxno!my spthrsoinnsense.׌morI eronrwof0emhyerirabic>"alwaysaas0fstudy-of- -Hubject1ian9zn銰icalead!YdPc#e@nksI"pphysicPnAgnecessa8цHكSluaЉۊ'writX.ԙ*ByePgostwlH,ae Zoiab1Ip:meana!(resuese:ל"'At0st,ϚT4po˛th.'... 'N蒐dmsFollow,AaYHllirmberYe :gateHbԐp|uture.'"@poRvision,Ɍ :li#l)parosaic I؂licearriv@dؘspPouslyÁdG@M0X,gltain'Il)z`rHșaniRGhQleep!off7*bu Bl٭;*tr+i ulP闐aus8yҁKljoȕ5describ0b0my@chonkUbbe munht sivinppqhaleigwiimiҷalk`quie)yoom`nӳXJs'sЍw`ه)=pH"߹"do 'ϽH'?"as>"Oh(n\diffؘpy.ɎG/ӦtoraeilliromybnowAawHlrtRnewL;ةxk aasp.ƃ12mn(qexampl2hsipҒQ2t@cm(0cprXhHoz(HqkHCubsjtruXR·pwhw lAPagshu2flori2, ɺlitigН0p`t`cep`aweedAngrrocۅ(feeua$pebbietneaȲ0WPaxcrowȾ|fIvbrzぇerLw2d8h*ɶ0sl ӌX콙ТRTrafalgSquAshowISa 8訩!y΁edyterpadev souX,I-r77yrys4s8HflyǹMhe8ng!iXlai(YsinceritXnotst`ArkleX" apho蜫Iur@!ѩfollYBsy J껙2mi蹩belivisr0mPw"sႂHtpPp;ٍdeq,9f 赒expXeHxȗ:8m`Jsrdpqpriv/-i@wНXrQ2 IaQյٻ uthl"һtqb<;Ȱhh8tt鰰l:utempordes7O>HnhIЩrba|AwKgoۘңhunZ؂8nBerceeвStpRY-osҠmp$al`opdrnc9g@ g VXbuiaboss...󀀄

"Mostnteresting,"epeated, "butowboPtheadyohomoungaged?idteller@atBhadeenndardrafalgarquare?"GG"No,didn't, leanotHoft.ԅonlyHffnceas wpQmJslikereforefwidet؁,Sissrospectiveatrimonialartner.owevIyddothismen`ffairritselfpQaisatisfactoryashionӌ's)m n@lyxin(o!.lsoqrudoughIbeli(ʂq܀)Ibmad.'g>"T2xprettytraighthjifalwHzao@w,togerurpris=said."Quit1jlXL@lyяPQalem)case.ΙcX1guesskhappenh_>"Ofour Ybroke f!ll/JqW`,rbothmioulb)toYrrificQ,yIriv imunious 9!xobetr1נ!xoodumpXhc@YichYfaleft.olAhim 5000iypol؂YYheol9Florida1stXrange-farg.nespclaimpmyʌn-iɟyyosymp izwiX`)lahiЊack(li򁵄%ءȁs.eanPl`8tudiArabicCanyدxamusam quicku RokoPm9Plk`ov(pspiritusideϴ/(Yyubtful"Qmakfunjش ,ͦ)rklGACertaiٱ Inkp5osebPakill¶nೈhum8.¹AshQjudgȑ equelH(shorZqmo@٭BAouXڶʷH+kiyYrs܃y5r9mqs surbboHp y1taIٶweintixconnnvaadtu,ط+ragɠwXireautiwkipAs򽈯retBp)@-k񿠯8xpl1remoholaX:pefinYdȼrZdown#mgQЯ\ azhr8ccord@onxcnx@endTwhHsXl xihspUurqxpeiuccI}nٵ1?/(L`o8s *mRdoesit7">Ye¾iwsy8pIemb)aneke8yarn,1goddes0%whosupp z Pchfromfȝca`nQɉh۴ؾٸ hu 8owedpȘ#wad߷ulAVagx(ft(+q*YZgB@a|unknX1CrWeAfrica,ⱸreybd{poAڷ:pQ."Vmߒ"*hncheerR. "Be;doct I}sahclusemini y (fmul.n_askfQQzocalŷZran8᭡`liyUKnʽnA򲙶ȿRugʇIPhnh19)JQf۟@Уmap. 'W0,'ntwinyey'j:youA𮘾lAa󀀄dyhere.tQorstouilletomeoodig-gapshooting,ndavecedateoplxithllucinationseverケtoyrm.'

"Ioughisxxcellentdeartlyfterwardsbegxkponyncse؆ouofricadvancxtradenestsf2fiɂAЈQoartnergreed;seyympazxyuch Kmatrimonialasca}0ahanguldoY.oo"'sase,'ai(,ho`8iftoHltud'newunes,HxustomhIface@reoPhelpful.'0sighokyhead, Z⒀opHso.""HowongÕibeen(re?"xaskeOh,lPWoaabzheaoP8whi;fisenfRuga͉YainIpt|@0uȄMway. t@hIetcup X@Lf`doz0cJser0t0mٖm,ڟcrowXaHoltQn0i9r``a I6ٙ5mry,fcٟrt9fIrI.הȗ"n'tnswd. "GoWWXfakenholisSaromCȜ[beyoit蒀eHrumCPrea"m`toYam!nguagI)durɦnĝٔI 0ttAbusinesAalsHiloȞ줉yossibocp.hui zԢjptalk"English lPnThxI(#x`pbyc to,r(`&vۛps0aiyMhiefch-docCnsy"8!aHQhؕ*m1yI4eeomopJ,wwhy?8T'suitue,A!inkZikali, "OpeRoads"[`wizTZuluam״psaHw>"Now0wQArkm0ȖcerwsXngڏ8ixe)cqhwdesoeauti8@ع:spoeQ!ueto!eA.·sayzves xnñPrsnQiضqnJZ𑱵AYmxx40Lipoo"9:mX,as)In lefSqaguidaso >"PYW iI5yн sPfw ixho9ifqxl1alYgȝ`2h9fernitJbehmunpth*a͚y(acòShaba|fetR\vZ@۱;ۮ{inrZ krd~sADIDp!wime ydssisҪ3nْXb٪,`t@ yfashc:daiA!X`ae IC:̡"جڨrdwelCd͝Ptit常oInmseopxsӧ8q){߰>"FollowKecl,ux3`ĽXrhȶtoo<mighdiffؿ)yPqQsȎtw0(!zx lٴ1o֞nµboȚAxPHq\hHʛRvolXoǭ0bw`climb[9declhH81PKqbetwxia 󀀄fiercendumerousribealledheba,hoseabit wa`oillyoneetooithinirorders.

"Ikhereatlastixenhadlungmetruck.heygoodellows,afudrave;everbdo2etter.th,y adyexplain0althoughfearnan$diar`zardsJg8tsountryfWPmopespeciXyˁDDadlĉ9suPinformatiox@l1bothъangen @C*ouaive, 'nispir@remcaptfPXdead'.orIreason oult steprWWPaw#quiteselesarguPre(emad@vagӆtalkok XЗ)inpbyoؒriendЙpepjgriculturi0 %֚Tvisٖ9my5:u9sreؙry)awire8If `;iIap `samjԛbС0`lprtxivi0Qtɛlik{B,ԛrpHfalᕰde-stuffѥP0nypXsIp,ifmmun clXetcea.""HowB]𑡧car؃ygs?"0as)oo"zn't.rmpeoplesed,!help5ch-ctorchiefsr8؟!sporromwoCȀ,쨈QbɃ@(back{roc`)(n1ovwxofy ᦱco1h`s( )ȳХ󜸩In糨Hyw_XUnC3hh؎׵ec1`d\dy,saismil`>"Possibly)'tnowČضҷ!:muchHbecaAYmbabкwhjmeꃁlizڣĨupmPonhueop8LakeͿqalDoouxsa hy,ͻArkle?'>"Y8w顺ucceedNoފؿ%[cln8,abtrp-eyw؅pfp upBqeemKAt <ɿLѠ"IqreayЇvdown(Y(cQ1ryAbh؆`rait0utskirts4aumer٦צҞtl{sۏb ernlopةXIun`tifvagiwcraxȪJ Ybigg)xr膲l``ȥ2deQdvђ fex؟jrj 0sufH؊xɦ\dIjpZaⵐ, 󀀄hasnduredorhreeears,oateyrelmosttarving,ndonsequentlyntefreexcitem.

"Thisrought,eaid`so,ttributeagic iDab8ahoivveIeim-mountainPYcrrextinctolcano gpes.hereeiRy(d woul0ttacksWdestroym,ordpccupirrHbecom ubjects$HgodsEngoi.utspangeaso8whichumpana9hnotaӀiexplo)."WW"Iahdth8KAalewithiffnces,"ɏ. "DyoueetyA"?>"NHZimeJnko5knowekyerdayZsaw sm.noinXfa8ex@rmblqoberzqfromlook i@hPP۔)T;Atwoeop@doubtl1onȚP(evenpeabHdi8HArabicHhdavo?asked,kAXIXZߟߟByyhin H! vellAXn.Jwmovisiwu8jPnbylrfailؕbs0Hmi0pclouiupieh(ake ̏Cr鞝hb.nw٣@teepatheeRlimbLc@klead8ً i wrpۉwafrpeplowrwipassqu!حvillagxgd АAfi.ȏњ8(fdogsmelsBrush0obtunmaٜдiinåuppвsj౩hyenas>"hiXmornIYѷ"AtPwnEfoi8ty-fPaf)arrivals(tsa2opЎЛchie0oxup(dHsur´Jke.ӕf3nXescCmDx0y,beyoimagi ֿh9bA࿙9rXItmɢ y˺bordIRHү0hؤ)9abNal;steSheasRCАI7IAȻf'HoL ؿxmsetZfoot.""Dyou,Ѝ?"Pasح//>"LhawɻoojhnɨȪ gpȜR`Pkgloo`pض)iQimidstxlveGCЬ9hu1ousmʭ rZga0nؤ[txJT[a𔸆rty0sidΎcsoxIXQ{asrȠ dPxvisxy.ҶѺPٶ|ȔoulIXX,oYHoidpe"f,cs-exasharp(reaXzaffecAansi!guerabiczٺp`rfi󀀄es;hatishedoeeisountryashiteerchantndntopenradedesirlearheidomfrDab8a;jInowotXb .eepli)yightsshould`urliveoracrilege,؅xmanexpeciㇼpossiblyma,Rmatterusrefer|IEngoi.eanle<0remaarisoner.f@leftErtyard=h_e@ized.

"Aqidccordingly.ƉXtlongayaboґ0horrx[h-fencЅ,vereatyself,bsup3withlentyQexcelqo(dr@nȌ(fricdoubГanxietiIelcloso(whIaim`Sye:anfar@rwaynbeHLondonarsPe.oHisitoȈ(cmhhap(hta remadnesretٙhsuichanykpgȍ!bPintolera?ߌ،Csaw0䀔\NYvictiZdelusionsGG>"Onewh@hyxt,umpana,ogu,Ɏ蠈sԡ0esa,sc erآ9gmportax,ajrfiX iaskZ9)a)hMs XwdamuchʗsfeYsoZ+ apeakae(phoЄmdY @amЮa8dӘ@H:wrlakP`Q)pmݮurinde*knXxso.Ԑadded:GG"'Woؙ9alk;tow!arsstҜyoull𵈚22.ǀ(m%b8Hu9ce ""me`rAfMomؠs؀{dhușUthbfqadPtuabac ؼ"n(yᦀerH Pdur뗠lifً񈲬6kwho8.'"'p(,'xansw!. gotOO Aיhhjudg.ӛo,Bbeto (gɿIr\bow!meppoؠѥѺYlϸ.*rifxp 0 ar0p caucapir @"atJeɩgu1ghwthrILllHe_[HQbtree򴙊A)`tood0+iw0Iur8sl8dp.׶ЮIѷ8Dpyv[9s5fee ȱIousongurPо0jm>"ynf!frbmKcoionyhumaPdspiritWR,gȀͭdhhabitЃBx{yrigh`;apokminōXnIAYhc"$lupX@lir"enjil9ghg pursu@as۾!ha@❲y?Н{avewoc(zKpplaxso(bl-0iApcfetispevil-NsymиoffaciMA򄸊"S`ؽ9,r.uHrm`YInϽgo,BBD٧৔д1tria8aa0@BtBPtȾIIufBris`f;3m eng׷לx$Mȩndlڧcbr𱹭Jtrunksstumb󀀄ledverheiroots,utestruckmndfell.0couldeeothing,hearxceptywn8faYeyyressureikeoatfind,xwasuidAsustainforourftPY.

"Atengthe`oH1est,rIaw rs"tffulgenchiddenoon,lseleamapfeet.y[sm havef0e `tghtaskdonequtllȅ4sens܊gre@solitudppȏXs؉WW>"Wዉ*upon"Jjiscerniblperhapsmag?o{i0lʍXwarano1BrdriftnurrensiToYIdhndewxar coat;whiteeiQfigsteppȆsh蒳toodeq@.Ԑ؁rawl 9ac0lighirrdeyuJ>"'Youda)mucomOrieșXt,'i@woispeakqArabic, 'bryYzIXtalxiPattlh8.'"'Who wH,ady?'pedǝLjH@whoؕho@&Xr|citXaway.y ntIۇ)isio`hPhlesh.Ơknofroo tinٞbeertxeomibillq0ln:a4ndeIInk؃ J`soPn8. ɈPoff,jXahqphsavages?O7x!inXOƕRplayquJe;yoracA5divm0lliri nopiPXcoZȓkXagȖ(mado,̙hhadowDuppjbYpږؕsԁ4maybdiff`th`ealQpweЖx?worȭpmaxbra麳bond R BxlsXo9irst8_?΁]r fa"'nP`1c "IeP,uthok*ewhoPsizyithofadnessc8gKumpana'srning.haunhomsoughtys.׃ppo쇩her`uperhapsrever?itre3omymsswepobreastYkissbrow."Thenhaumult;yQhfrimpeako@S89wrenawP1van1O#ha)Zsgiants;sensesef@e7>"Wy urn9gainH2h1belongfter(hrun(mtid@hpeagzmedrȈ."ign="cer">KANEKEWEARSNATH'%+2"olor="blackhb>ArklestoryáanniaidhLuckilyepp0yexpecI‰k2,lanim,wslimp$likeaeahPey`sp"_Xlipbughel, ra!rȞvisibeyo5!facaXint@ixsmilଉRnmaঀsons hypicXflu(1Ighbybeh8 *(sirll7>Ev0ntl+mɶȴpQmH,󋌶l#`my)ioladȈoYliv!C8lat9ȓ}Yconclu3victu((on*pзblly.Ʋ1haGi¶qaXirituim8twqoul (!ci@xXs|stliusI>ѽXЕHimagi w(un@r ʵpdiax9rparɌemȒpsex*exia kȹhFat!hx0jlAžyne0flif2de//>Salsopul8becau0fXuPuټtxoť$ow reunгwemӍ~HadoresmQb8elo@lilly>WdoubtIZsubj!ʪmcraz)n8Ȁas 8kee`Yimself8X3moPmoxprocm8lou龘)8robusXguʡerst бbvex)iniqicism1jfollxd+s;3a-gosȢhysuppP@s8Ȓ9ZlocalBfemaJ۬w erfulragۂistpP0XcrossfricaUne負rhoobce>H-hAtri "orshippqb-fetishR0ch-doctinmHr (nH࿉ xuYtiq(0n҂)).atlln*д1bePsebYikepmier.lغykH,`tetwarnkan: uns0xpoy"d-assIIeel">TX,X*0no͸ѥss)lad蹰mecr@hɲbHgਠӾdia.Ӻ: Asatterfact8vemomentnstalripeorischarge>Wetoppaewinutesrexdrink󃘇fromountain8ream+e@\outhfuls"ood.ʈwfinishhasteal,,hos9ng r fyardheqturbeckozoc!him.w when8cithXworeoinA؎!left>Iooke8dvancalo18lؔPpfconsiderablylevelves,ꊒҋ!tprecipitousrcliffilealf, pperhapwXway,caughtɀ0xgli1sphhichhkn!bh}Par8hsun>"Whht?"0saidGG>"T@Ab a,̍(, blockroʆؘthrerɋhListen,w. 91fabove onpash rungh c;h"چowi"yHnbepslchoqk8a.b8d}wzßiafeHpwn8rhrw1AlXus.Άaacetwe8@sfirgALt2.el dy(s!arers,"rGlinmpmbgpߧ8-s9alb)"Let1ĂyouPu8ulive."77B( tiArklHanrP8szj ArɩufficCexpl]situatio9Ȩnnsua ugg(dei(f!. ѳmarhtt깡H;re0hIxmb h0QБsavagX2pa@pfhiaq؜ la)hXxshtflat;SuЍą twh t\a9xplalsoqt)0dsaf鿁:=yerd) desogq,9ʭ rememb蹸ytar*umapwonP@JthdZl s;oubtoy|8cp;Btakencle(v!蛻-scolur eetPPut:ww"Axos8eyzTll-BaaؘmwiX n!t,`!O , 2ox#bro˧+h"m p+Adidn'𤈾ONHɩIH, "U's, (nkwǬIeVYe؉ۃMp@֊(Zheelalk`#cZaŒGbkՌ/*bXetPlikPerxSXhmackrif;߱ߕT@0ny`t'xXook2f@aneggټ@sʾ`b(phock-rabbi@HEes)mepcaPoreer  jSuppIm}shoXaimyxlegꚪP eroo""L1bru蚰ʶ⦩rh">؛xmѲTpgrowcah''$QPermأؠphzy1servantxIl myselfLJ'repliP:s swPtoHH?G">Xn8T!JerrsaY'alarmpwнmiHtoo,ndeganoirearcasmsthem.

"Whyon'touun,Jbraveunters?"esked. "Willjlerselvesatenywl-man?frifl@aheavySmight`90hindsememberdidhelephantseaf`s."OOSuchChisaritjests,oranxouldrackoktĆhtpf.nowwards9regredsearnlynoughwepnlnk!whiXit @too슠recall.heytungomzurhIrd mu:"I' kMtW0ell,"raJgrinnגׅ8o@phlegmaticerQhowever,nsmilpin0sickXfashiomadeply''>AngZquiclosҔifaccliff,Xssayxorani0ng,󅈀H؁Bass cleft.n(ؘ8l(Aba;dee8iradyspsmhad 8rgfro(YmoPain-sipabouredrhyawayoppsl8lavaKxcpoffanekectipow emzbe2yamhiI-h9xbol)*-:likxeeHIВlehapnaHsasi>"N)eIPiʒaQgȢQbrutPit'su ryD`wh8ot8Ӕ t`i( bȣ٨װ,aas@puffШ1Pho1Hcyscenzhawk-eye"LookZݯaltwصi:u"ڮgw1 Yp eeUm!0]limb+itW">IYAlȭno8bservyyȏIcu:JH B!ܡgul@ٴm@doubѷhPqont8qag"#croвa"Push! criۮ9cye/xFont3lArkrupmȋlder. Qlnx`,ȦixtsxnX, XfcbsPreviHߧZw ACit?s`wo`=px)ėb.r,Hyiflfi`"onI,iss@.eIm9PZcb`strʬZbl fep`Zs(iHpiecTeh ohightiưrox9NCPon>W4a@„Z4`cipon` ipexXctol8I0qKvprJש*peop{shorhhelpcZwh^؏XQu󘯹zqrefug''">5sPd!par,XinQ+Htidice ڰfe؞űraX"errible-yowfurioiBҰhcomponapidlyc:T؜Q9M "WhXshoot?"askpeezabx@gloom0hol؄pokchoes5lah0tiawayweXfollowbavaye(!riumph>"LittlelX!Jerry bvBaas,"sadȀPxipYbwisle"ghXdthinkwy.oueoirivbeid\icelyeИrH21edongXstuff msesΓ pa+sXclimbupÒC*unpasQ`givyBull-iXgetfr`bdidJcwnA o {frienSoyuppoJȢ҆ndeal|perFx*gffu[paHthr¯[causoɤ2`R,reco` PsurpڨwIusyseiz؊ȒihPhry2IHfѸ@bolђzj(a 8tun@lQԩɇl.? Qu>"x򺀡br跀-f(ersaɼ`࿩neHIwal9s @0roacghomPa ghaXxidoub|h9ou@r@mi ت bloc> exit^steep-idHi0ewinutN9enabpf!mWheSʯ)spontaneowTuc۞0mpreviilu"{wûguQar0ac㏶ȷ@ȽL dɘgibdoZk.taZܽrʬ@sser Helf3sulD(0i Aphonѣmry!ϩmXop@2q0ceunnbЎ anPfiаW>et߳fWrooќ.ܿPhimustic蜉awguessD0ꈈectruĮYOywplhdlsouXdiʶegax0 manyi;jo,`ke̷"goodh ti"+j "P8Fiخasynony踨P2lxڕhabi.erPconsciensmotlizCrpngIjȟzb:ȓremaiRPthgg>Arkleattituddiffnt>"@,"sip"hdoutaxȚe|h8c ma`at8?µ깨fe ˨8kaԢ*dءyou[pani? BAI፩Xangwardm+bligat٤Holt?"Ǽ"n' Hnsaril"kin,uppose.ouadetterskimfevmeetgain."

"Ixll!"xclaimedrkle,ndepokenotthat8sacewhitPithage.OOSoonertunityam0Weoughttnwisoemoearmou@ofjcleftXl nAbaf9a0mp"ollows,ycould)magiPHt,$trueaneȌsaidw"bo.hereforsuggeso firo ledώ>Oniwen@ccordinglaarksomeourneyyfirsittle8reachus deep*narrPholPres`how!,idenfouBrselvespflateaux`liffs/>H8mait02seprockYeareravagn;anyHseehm.ȗt beyș)╀me:"Knowyy/afHLj@sass`ؒ p`(y1)1Ϟ–rVSoee,"IsarcasticalY"bpraX9kvs?ooiknew0becaupwren8r(̣ڜwoudis18xil8hЀQ?ȘYf!Tstrancmanpo2 malevp;I\;Iy`y studyhen?WPBU;answbr ispea0g yuieXa8wiervoicGNo,W,oَئ(inkhopmuch#qbeli`̇!@1ɳ lu(rtomPRZllanaM+pҞ铣 hhwmlPJo:tAme?҆p!(ChiefeDa%LaitsԮPsulЬxissclxcudden8dr knifHdecur)½SoXiorsp1^xswifa `iШahbuckfhrPmAo !PтtHHhjo;ܩno,xdrawpol;uxcepرڐГastqh>bewai!:Jm;o(eqarms9x9ȶYlefQ跘gririghrmhi( ai40tw))suaaspirfgWKseizس0y Qhmokȋnheput!ng+Aruthashatfull,rkleoosedaneke'1roat,ripphimn8srms,iftfromfeeanxurlawayohe(lleocky ound,trikingtixqbackl@reenseless.

At @moment@littHkeen-eymanhIadeverenefoXaa+JcornHP,unnacrosepspaceI ,8ispapidly8xrfashion!onhoivesucts.oruit tim8h0mPȄthunowagaknoddAshowݍ0erstooeaҒhwhhd. lasAhl菠@ut 0aHrexclamapo[,sawreco(9swoon.hdSLxrlef؂8Іq ÐminuI(sigh$itpow>pickupBknifsporQeЛootbre!Xoryoise//>"Nodog,"sai"Ie(you 9wou8have?Qhinkb9sest.r(X1swath?""I{ZmmfixᙂypFWW>"GX.neelme.>|scrambstiff0$k(Z Hansudg?eHoI 󩊓ե vXshfaradpAadcmbWDab8a8<,Q ur rsnopub@summ:myt8igHsatypsQ9AjRtts;أY(asavaga𭁳ycmg`pppntlinenЪPqcolH,oughQЬ0sAbbdbluߵKeeprf@dy@1iKwadlop">IXYHot`chPdq*tgȦZ܊2causDjВheinrcon( 0k˼'peetsHalcut9ɔHoogoice:"Welch,umpan,u0iTYuLLH.٪a繹8r.is8ټ5Q Ȭjag誓g wrbeyosx(bitriKmurx`wibt 9una(I threXyȾ(l1Ryȉ yᱨȌOӠYre upYo[s`jmHm9Bk8^peop73!Rcɫɇp ifref,dig諀epgthuȬles;taЭi2e9ieecho|ʙwWP@Ԉeacouss򟧷Iube@xicgavmYphwselrHHthJsert.y@ylTWaPgi.׾ZtНd;ޙHPy!бbody2(9ϲS"EngoiSres)hol0딠IkF dee cШzɯzmWgYнkiHenulɏܞ""jjibbڨ(ppadoo>"Conueꔪ)wouldqWW>"Allw@"iuѐz ??i1QS@dPrvKdoؼ!ndan,seizc byheairithiseftnd,reparingoutff"headcurvedomalinife.

Nowaneke,videntlynreatright,ppealmgg">"Oordacumazahn,"rie"saveyh,ɆXayou!"ׄ"Whyhould?"answered. "Justesertpme 8yeoplsop0tworhuntersreaH؂Qbestay8behiȋfqus)tk+ynoxbeen*b`hscanalkveDmɅlAwh!ago.gain,tьurdHсeIfor (sonsichdoun𒙉afrh8sworQarmm.ystrengiethreLr j8feiosYex" nessr@ ff she2ifllcha2ponapْ8refusʁҁBsSoo1beaid?_>`timhaltgsiA,ڟbackaawardbm2rremhHsil,Xtc`hpoceedxqaQfascina0remb3ArklsaddrȃoDab awhѝP pɦs8.Ԝ1madXnextl,8llY:"Helpx,ϢbrohomXg@8qrulW"Q)donB(w0(:ᛙnoXodurpose? 7u0iP-HoLapٗS(ȥڋ@tsȁX._>"Yes S@C8ᡛ$,y1@nsᡱkҢpф`a[(lGB. OII8yjudgtwQBmanO">0astonishmHobel2=ey Q{JdvancCZfppac`دITlittaRoؽkhXjx`Hyۀis𒀥a9ssXѰ@(o's xȜlook)tY2'>"Greet,umpan(egu.ba`ѹAcounsel:ga;Iswi8ʯ mo*8ta`@lX4?XC.ʓ*9OhʿoryXcc@zocoQ M⶗٣rr@GhItḬP0w"unl8buys) ٿJ[cd p>"A8鶩x!ؿ,,pserqi>pl,[oxqr!paXTyhso,׬Z)__wwxbkܾBn!cX ڒHurEngoi;yipsure8fulfAIR?+("9ip"ߖٟ; lipJT.5#lawhPػЀdie|so8(S@rpI@roachHnecklow0re迪Jw@berefusk8rpferrq罚privg謍Zc$83omhou8rƬiٲ@invf(f;shȵ@lec!ft۶0s)g jeliЪ2ȣscepalI,beghhfe@ïqueXbmI X!ѽximagiXK$)8$1ʿ1C rAȞmysimo8monvagueXfahoPhafrHprejudyx0urc andhenft0enoughutybscureints Ysymbolicalables.

Theathinished,anekeissehitean'soot,chupposasartceremony,[troveoise.…forcingmhisneegain,rkleddreFlittwi8roldo ood@tcgll>"Telle," sai"what0you@umpana?"lj"Lor`th*IntilowaXhid(romkI@hheaȉ3CouncShadow,Ɇrunl _`BZjoribe((return.W>"A˓#$wedsoNa.Ȇ+lHShieg dis.aterxecutoridecr.shiBoוenc w荐becauounoben`ro"aw.ightyusb! engHt)guarВBHك/dHW IfؒBer@,ϔmI pМpriXor@mɔe givenߖInkÐ ՞蠳љ`lso۔ٙ `afashio@тwrpHco8ct|selfsuff2gopuOW/t;?"UskpOO"@妠des+LG˛Iappear9Hroتday.ƀsHQEngoi rנ1laXЭOl؛Wer-by-N8uxЃpropHtim)Bbac9fai2@fulfi [Kr ,_y- bpIr٢X!0k _trimuhsylifeaAtx, lYlaʟ(P@nam?A(S߼t\seemoansdwadoubt`lsz. "jir mat8subm3@on8onPXmayPfaЪкl ponmbuy?w Yre"">nAlookyrablsay:77"$mDabxqbeH8tr [:qmy{Iyet doxe(0ɯꗠcu 1߹$aؤkBmf1wth rri@rnem@ oXI lowrvant`rc`irYths1HaifHeФ y arrs.ȺPus`opi(Իs o٪76lغCreIs*ydᾚneh2storNY1wXysa8ec݉E4acrifvشqus;agA,(foobleep׎sYЕɷhHmadbarQӭQs@ngȀ墊bep٭@ѧmaX;ùbmplerf9y y(mycohʖbct:`xce?ā LjQgoXsڥϯhy narh򄺵up]pesihifu0yѻhelxleiώ,Zgivjkxb8jney?|JQg8ackIJfب8erisoww">spoBsrfз@"hsaid?>"Oacumazah(Wat-by-NPҽngzُwoi.tp.finishڵrYH9ʎsersafetyouemand."

Ieflectedoyselfhat(isromiseasague Xualified.etmemberingIhouldertainlyxtractoneoreavourablbeoroughwornutitenfioce0ebahoYbpewaitside,accepI for0hth,requesKumpanaleads!wheeXspnafety.on gn="center">BEFOREHELTAR+2"lor="black@b>BytimIx8rgHfpass,sl@noؖXbleft xckig-zaggcbJlavaooeolcano'sip0whichdinmple,en0< ,Edraw:owardsvenlx`nhfloodwijMwisun.ɘaer)rfulӉi,iBits,aX!p monaimmenailЉ8Africa.ook*zstretcawayZmile؀RifficulĎgra!sohugVrpaӄlionyeargo蠸beenHlak@fire undoub HyzasؤiHa{ppiHҬon؃mĩC.owenclosXaxexfP(@Rslopgpdow0o+o@nXx>N1Z)ll[glP :Kbott0l-pH ,ygphwoЍ¡aM0ZkhBerrifyqen ux⎡ „xwccof𤑚Bur7Hsin" XuXai8m< bhPes>A1Y0,pwxIopoudyؠndul跑peatglpI؝la d-ИqperЎKbchmanp@l hiddiovtpalms.ԛታ si2chroupp0Xup-unk+FȭwQlidulru>r&aP8tablIairy;2@rAmuhaȤc-3sidlhfzb*up2YInklb exhainquXBnatu;c>OnPɃsKumapecessaД؞uP.כHǓabsol(1kmɬorغPwleepp`ڧy(remembpreflectBhyyp\r9 sȤ9humyividual A`"Xvalu,@peoposoa򿢌ӵiv#chpKane࿹elseI꒙Iɻapih1XѶ@dahiIliArk9`">R ЧuПBYCgCXHhȼa"af9y>"Oho,ap"sC. "You!ed-B``[Pqu#bbirthr2qexcnpsticypigR!Biz Xno\chief @HHsabaaptఈ ca้.ȕ؜yykw)upAzsLZA1g1:eie򫍼cx؆-towP.ͫ@Ȝ@!.""Wrm8ټdɞ@aidPk;n!gobligUshfJatern.ouee,aas,heRed-Bullhbecomeriestndhchief,jsucheopl0reeverii0wnasters.heymouxspiritsmen,uteallyqse;mordۀxbo`hyike.o‚st,umpanatayse؃guardxIbhkfs @ing,oet abeXppyhi0wey."

XdvichgooIcteponhtHcAf (phasng⃺ -hou؂builXtnxcellent׍(ewfid'sle(withuailsi9rememb,dhemorab`1f0x†PHansoduckbagItobacco.ψ nquirybpped˔iDabparth0bw񍨄ЖsmokXcig@tteȊzofth芊coPaliebHAlso,ntuookJ(Idt9pip+Lam0Ipvswecool`ou rhhsѪٰbsf𖀏tart8ideoffw!1xr0d0ldirect՜0ЛO>N@vcص8ondr!mo@putilac(ctrulclimoMJ(1Ji1H2larg0re*ecXmahogan`pS`ixxargrowy`XuplPrsgrxyl((shbrHark`mh nȶPntit$game;xSe,븨o@s- elo(8a vapt$blwildebh()xia3a(sh-buckbigg8س2n$efouqnyWIPe`8elepoce(@d;an)Z!`onpĮĺ)uXnuc8TAird0@T;9I@lPf0!ricol4sizq0lh" swallowInXЃyysaturalظȡ!ynGd8y(ῢLҿPthaؗwewɃ"tteamlcTprR0rn-ravinPtowkeǰ>AYIalouti)y!oaxeüPol8le ƆAhimgjmuinRzfe٠jlѻHl9-rp8ArњO(knp( @crudomyg[origin^ԿrK"sy@go"iiheyDul(XtwHrohoyrrednsuivi䡐r3)clyA5Engoi;dhb8upwed;8deѼj auÿir f@e.Ӏ B=heavup+"o cluoY,0vorcq b<|udrn (Р赡rsu(MmeaIљЯᡈcr)a=choyK'>:ime forward,umpanaxplainethebandaadoughteunionithgoddess,obecausefmaterialnefitsy0lievedonerift,uchs8 lenty,bHmepiritureasthatBdoftiulsfeath.hihowrynchRincecurupemontinuxfromg8o9.ndeeprophecyzir؃otfulfillul ighiestEngoiChusQ affiaxCSow莠whalsoa2"iTYuXLake"x@le釁backl{Damadeabetweetcarn!(3nowngratwy:n!"C",),{birQp,wel(is holyonUouw`ٙ,nvtdarattemp@o-0(-rntryncirccer'sl{.

"Why,y 8ravPnumerous?"ɛk1astoniB,oAdi3cwf`MpHshisXblI.t)s!ڡFZwe;itbtҡ0XyouȤ(i)aФcliffyrdaiwXafHXb٦erwਿahfolldkՃؔ0Iman@(fePFߦ`oxmSybeem^truȮdrȽw8*qֲ薩pfDoubtl7trtRmb`+QHthre agPIund!s+dhe ..΋m9yX whir!(ɿбԿclI,7Kipi8ualxar>OH aI(su(IPs8timyhinkCgHh`lA0ca.ӣC hI(mplRtmazp3I`nd@*svelop"@rooepoпunapprecih`unasoo>OЧĉXppaH`oً Ih|sil.eiim(I鵸libe0mh1necarygepar1Arkl8pmch"T(Wr"aIlbus s7">Tonغ,hxȺ ansлquQ@Aasi`atps ؽ`rep@dФfrankHPknew HyPt g>*stary!uHL,")!. "WP8ux1j8Cdon beginn8;h irЍxxobxÑ࿘ds.agto0spea0mhaS8ٽ1s{udaRwxq`:H18jy2H`fupȹdoƥ[`.ͻ @p)#…qfaoBjanekkђ1B90crذQrwi`c8)hЩQy)@WatcH-by-Nq.ԃ[Rsڅ(ó1 die;ʢCdiss|`eng9@$dhponim,she@commanded,f obeyqtorotectromllangers.hatswenowfreas`pyour!inghough IIee`2adtɄHPrhiteordould@veeenilled."

Refl؃+thPtaleboutyself,thariationmuchBsa`hobyaneke,Hxlnꉸseeopl8bp`IterynyrȂanyhancfate-d؆)messeɍW-ousHIefubjattackednforemmedHPnXest,0lykArksayhright:77"T1WQrbB ,umpanae8zcountryAba"guiؔ o{own애.@yiddis?>'9ged;t*aeilePov8milAlligentHatu8Әsecrecy.ǔ"LP,"Iansw"QЍmIД8 scarc)lawful˚ speak,v+oSzbfrieIe"ustڞDat؜folkam闫n0cHhliy(sdoYhstrth2BoXhenworship#tar(ora S7N٦jH3iritЉtea胠thrHmhLake-Dwer,ӥow n!Iears੩, qQey `gifXHvisxsoikYiɬc1ҬdarknH=paalooknurtainh")fuѮ#b(dA`i@m"Mp wXquepo0iNj.ąmustfflik(.٣ƫth;sapf}aIs(aa@"accxodrtPy inhabೢn[.ӏtoȻиMbts" (IYȰb#lepts)hcaAY_HxɆ"ogsPHs0 n,up@踰buck o1(8HnHblulde88ZIalway(rsavagX`A(mamoȓbPh ;Xyara. "Nic)Ĵ)mayliX.O>WȺteppPw@c[my j,Q,ɼcs`kP-svoicР8li0ж0mplowowʜ oh}nwiA);UcowsPwaitke;hsPpat ubmiss8`nt( nw#norsqiailxp8ȁb)CgIarh@pJcharHm8JHXJbPfikeejmimdy{-tIYperformibhgnYurngamboБf)q-#lumbKfa(onog!Baas"L񣟣\hchap"brutesWPPer@IsxIyostifi\rgue;ʌ^Ia@gxay(:Bh ̫2Ip¤dӶ׵brӵasYus;mu?drſmshhl`l;Xev@Щy0hq2F,̷ ,fY`snaktbdre@c0SPatrickcbequmlbqDabaThi"wo"ontrolc:sum"Jo ypphQwh! aopxwiz)XIIh"8zaڭrt W880guidafwardseasrivenway, iteemed,oeath."

"Iuidedim,acumazahn,ecauseɃsoomman`ndisppointHplayrartnur(stor#once(for"did1tpast.Ȇ߆܃isobedientsuffer`follymPeHhich ‰mustHunish0learKtf (ror.skeЅc!rning(lorII(nnoswyou.eHty艀th$allIdoney8gL1hrself">Nowpropos mhhir`)inmatio0qupoquessPondrousHH, sacpersonagphoawelake8JIspec,Ranfri @olge؀Wa-Spir۔Pfou anynds.‡PwhHI0n ɑna@Shadow,umpanaurup8withQfieraokeyes,8rienough(AXrewil.ww"L/n," Y, Pdo8liev pri esPQEngoimqrship.h)haXnќ10wPtH)ace 8֋ptoo\(,X hЏ!8ygnoraEcornfulfaIaP irwnikmock"Baaspthh"Yal@eeknPad`tpeopla1tiI!nkGb!eXkll8z8iKane!a webPщx಩ysudryQ ed-BuCa s` wiwh)kXed;unʸabr(ihDab#glaY?h !xquick8Bo0ad ar?) W-MԬ\c a[pretthnX1`cdeceE,ڀ,I4E1s௹؟Jru(H̃yjexifʈ dmy ?Ϭ`c!inȵ)ȴll9ܼdebeɅX asshebyhopIpshAgal-iپqkspCSnimeleph0GG#hu ("//NImemb TJerx8alڼfapo(*gascase+t`ubtlfѣtB [infȿ.ow)mmitmhurialaqddenmYcg,@inn::ww" lXlil<;clbiopChri0ʳhidefvil+mXoheeXhdiH"f ari9guid@ChexupŸI "I!`irigraaliesevarXu9littleeoplHBaas,"aiebservantans>Ighim.sɌmduriourXrchrcr0r-lIYmofiIun`ppBIwwignZcultivation.ȍpQ\xckao pasHtwothu@surroun#NoutlyَWsmany@sticimals;3iraoccupiwildmNeaшpowevered шXaH ly,`flockong-ȃȃ8oaiCrٛTЁУ#con0,RQnif8bЇ1RZtecpmocaorm(acmoPpKumpana'xt(isِreashylefIPt(ed//>WemS begnoȡ`lk ipІaexmtPSOc8oQ(usromRdoor-w ZhoPopp(Qwork𙐓Iwh׭-mightP"))`pgr-Ahrepfperhap(foll@d29(yretuqPeȯScTIuAan1$8ouXnȔؠqŠaxcept-rklB؄yab1O;Pxnoolk(n*xHchaicش@hriosityGG>TPe8+ut)@impВYɰXapШqsp`u0msinye uteplotus-eᰠfeltIenergPfy ecaae8s@ mvR,d-gud.ӽ myir(lKöiismfaypadi@G9exm1goloo)@geCk1aoۨrXuin-r;`kabtooXfine-cHfl)-colpsЃӻRalf-aPhianh*kar!sleepowl-BeyiʪIb8vplаgrowiggjnif:d9ĶxtDkɂww>TОMedZPp˸9wzbe؅wic arket-p()lllttrodAX)vQ8@jȆఢЄarizazwdkoccQIuPprl`Yefrՠq0wiQi:yanyyȗ+<en𮑞xsolemؽ3t(Ke0laٟjudg(vixP>hXlpx8as9XmilHtX {cص(XspLctث`twooi񳰏r(XniftbsixHf׍spi1irɔrӡx@9wk< tno񣐽xӌa(uncomȆpyramiR&bu2pire>"Wɝ0,aas?"HOOatch-,"ЦdǼǃ4Jzcxxexcepky?"skedansgain.

Thenuessptheirealbject. yereservatories,nruncat`pyramida8tltarh ptsa@roffbsacrifices.fPishadittleoubt,oughwond2wh@y'doo>A:omentnoim0oakeurnion`forus:npch xse Kumpana,orejoin8usnzoutskir8o1wn,n m`lodgeflat-roofs@largthar0,xcepted9ingHictookbdchief,PjIstsituJinard91aerfromTaor-wayʋ@build.t isbig!itesAmihindowHSuplighH2cahrZp@],`m8hunt.̉Epasufe@`!attack ieves;deXIarqafterw(s9a PKfqu(8kn0M-l>I!Ȋ{ye ,8fourooAbe`carhyDaborsJsYnaryrPXQspalammuniKpicc-potlbeaxpPXs@ryng; Ssusp3coultiscangarticPmis.hiԠc1Qf њ,-hiSbR;BЪb§oP0eclyXwo@ksee0acccurio0al8xPeaufaubxr٦alowp y0dh[rn) 0madtla۲ȄjsurselpipslŮXCʚ( m>B+ if@darkpp y wѾ(GehmphelegaXboshap)erfilZ sweexmellvegetaboiloflckxᵈpqhfibre//>AE`80dѭJnbitioffDoPAҷ!tIm-(bedXaǜoviIauHuBPXmиEaAfric0haveloc1i8str;grh8tptifrdgrgavys1ihay.lrywumpanaYsa`½(duct1`Я8Xy3 rx@W(8T*yIoPdesiHpqCh 𵡾+nt׷>m`gaI)8esؑ.ȇdStsuppo𼉸dultpulaUtXegb froҐc:pyramy鼑spoke49Pޔ9RhXu׾qeiqōھt8gagKsm#irxxcipephW3ylohp`hlefth{񇇈`30Eup˂ ntyະePtm#+`ar''>Ǹlowta micBabiеhsqu!bui 2b`kvط3Z!j-ro8faĉ,1mH(kTest܏h zy+Hayjr8tX9aaab1nZүhrklamXɵ@sayorՊ!eveahio,B im1 cume.ϡYX谰l(cl8ےA_[eneKanekVfier ullenideppearsiglowedtrkleithisreat,oundyes.otkoncehwXguarded,robablyo`even imromaking@hettackponrival,orehiȁstoodhreall`armrsys.

Aeco!lJsetofa tIucp,ans,hoherauncom`txkepiȂ@xlbevolver,Ydire9ystAme.hKumpanaeftsdoositifacكaudie midway`twegKanekeubAltppriestHerXe|sil; (eHryonk,w!I8"wpsomeo,hي"ealafllip">VPmssivZcNqXiIygQsceIaw\ehghygopch㏀g0itsHtday3brBHrurnqi3@p-bluky otb1hIairtirr(oy1@eesMH moAlendZrowЂ[wA0ooftownӒXmBchcDab(aHl)fewsml@exsҥ ⏐$hcigarettxmar›io8rlinHylikТ0nrickdumb+ apacepme2 𡵨bubjegr lԓЬsXousyˌjHTsav𤩦HbHu)rd>eȉѰHqrmٯᰰ!;sorԲhquishifafooHcaus nail2bag hplatppois~louIt ģHٸkm2ghhXd񥷌rageoAcopwɬhco2miH0gda@yscdesHrɵ)Iech,uhow{(l(8y ouhd pvwoul蒸¿ePam YIisciin1Y2suddenjhbrna0lodivoihabohOO<cay 霬bsԽ|topqeaЧQcolumro`froIӔ,aqte-figurevnT ѱPRnt!L- A(YsimilK&فmnsнgaunisoXbolemw(me0Pcyblng,oinzwheupwarp">AsignBlesѬ("lifIdiSSlqBeautrHki\FyнXc P(cPregarbPwкgalkkeHsɠ0pbassp)vPsa.œZ2usm)veyꈔ aoloȼ͓`|@`upppJсsr(חSHTea(m¨R A軠opayeragٔbeu9p8abxarc. any ҽdiffmu脺9dialxArabic@0peoply;oQuis` i, "Engoi"'naEDie߾>En"danasArklaպid rA)up0 Dabagg>"Youget,urm,"٦͈(2)aiefa4,yyrtu2capyerd0betxnYgqemoI`lؾaKoff`zq,mr؂ "0boubet(m.ƵȈ1#20QѠ9otars,houghxactlyhateyeadannoellou.owthinkuarebouoakerayersrfferingslanetenuwhichieelazwaypnearmoon,ftermyHsei8beried."

H0asight.avIthrowomegnefire!itڈould p!hrpst@urned Xfacengregatibelhand,ointRob8nymnnNБp1pexah@2seealiRrpߨ>"I@t.׼#pm)fɬȵbind38man Xpϧϧʬ urickxIoٗׯaIirriorwis`;t@PXst>tuHCouncilpl0againseչPi`uoӞiackLɜYctpur).ʹ!ilfA龺8efmoHjustIouЙkil sxgPtrYviolYյW!auaxhubi?‘lؽmatbWaiighpڟɲ?sdoIctry?knwmagic(s,Bж,helPZdqծёi;эyfoubr:;d:\hclum aK8dgbyc ex af0e7*.eؿ,2cߐߐۥ9slxj nhe kneweathasearoer,heilledimhatightccompanyaaven,rimeorhichrouwoepon).

"Sounseale,utay3isPlioldeouncilfShadowfavouhtepnder9whmader`romiseo)m邊y8llivinkeepingWsteal"away,8#Prulkl."Tstatement,Hnoticededdisturbaudienceelowmo@m,app8afterwards,anekeHdHfrmembersfamily Ȋdesi%shouehiefzw.hesPtiraihttmeanytsalegappzon88''"Yes,"nt`, "su:ccursplo0strangȑXndגŚberev(Cmpasockqgupianpirit1LaForest(fP ّ(͈a#Aba.edidPecauYs(,ordacumazahn:`q`d ȌӜ@c@trpdoubtlesalXiparxnZ:ɒreП\Г8 ʚW">H@remarȢ(oudoјDmAweito(9I :yȥ٦AookЅ!continued:WW" rePe *P[PexecujuPҧB-bl)Kdscap␇overeª藀engthSpev8magic`sw)oYyfY :jyouHo8Peop(iwrobiarԭsu*dOracle'">Aork0@er businliBishpshionȄdirtyg!"raid. snQsXйچhfapⴠ8wi(ZfsD-ert4WatcX-by-νLabo)dh(vanڠdo !ownalso`i# bGBn1arm˒A-bpkѥ19ujolsehooIЉd(o横gaiJn(rswPslЂ!߂u{tؑpZixlBнphustabd0betwuXAnswAW1k)a?w'>",ҶW%omiBuedshNaphlӎ mxpL(VRtEngoifc)d,逹bspokHwxqrurpatӗxIQlip`Kumpana,bCXc`LSow,ummJiyc跲3seh\__">T҇кo`zriPhYr,neLطL-d"ndrl1|tЖmap#ؼimselfغAwxedP(Pqui:d@Oympray!k.Prchaspy(asdoQK"hȂgɞmþH+76ɡ+//"pign="cr">SHADOW+2"(="blackb>"b7n>a?"I pArk"Inkoۀa Hrepl߮Iues9ɸxarrans`вtexxohe holyersonagealledhadowrheake-Dwer,hould퀨ublicppearanceatight.tQ e,ndnde(probabwasBcasKaneke'sloRheadsour`of loawZbuthyccidenhichhdyfitHith9recoivlan.ut,ttingwoڀAtogeXZsuȈHxistseem;meoreme.fter @Љ bemqArklstory,upiHnIdXspr9from0usionsahPhosuffdrePhardshipX؂beenunIalmostdhhude hisHmTtwin-lwaihimQar-f!cxwAJrac :hyzdybefyБ)you(mwHnstroymaginat(anturdtalhav`uy@0ilady HɘXˀjaclh8*rxmbnilfHimselfunnRrifs9Abxa.

Accordڙن։ochove-affairmassf(ss.ԛ@, (c0ougXonverڢ!yQqgw( exiejythspiriɊal0es,ioѐSIy;omgkȢmyscommun8.͞(8@2ncsmat†rusXte,y?ΛPbecau`!yњpemql0Ack`(pained;Ғɮ诠!viol0yc0tԥbyIos4 siٌialsoo y rؘiskdangevZ𢢏,8ook>WpplwaypumˮQHQ̹ypeopwishxagsɟk,gularizyereѮPBcȳ +ouXo嶰(part m)sav emi-|a]extAi XstifiYྡྷum2ges pvowɾ)мkul\t ` !A]Á꼉clXWW>Nh8ap٤d,sIpɑt fom P!exVdesiPɚXk[importXdyntO @@hyidumpanaPri8Mini0xe$C@cSxow,┪Ark8+gui1th绂x+hiddhFt 8Y *?donؽ٭w (surУZ TprtdiHnt0ormollwayv wpernliffJcra,raw!loudsfthalf-moapptsghallrectgplatevea󏨊ЊsQnd9Xfroh܎: (tPao1array(gyeryrobes,reeyym؋ʐewnthHl0.f r ceonApwasg fair-skinҎZ hit9,shadow@barkeilh)m@unl iwiOHa masbliloBishQersrXmsX8bȗbrleP Xkla(.wrؒh`abhjelbowh-aiome croPfi2addchonuBmaddootnowwhoff)KuaǗ:La?>iflicks trangeHimpivHmysticbeautiful;Hu@Imembcatcmy,9ir*ancIfyub@oI{Sm*Tp:udieЊpQoicd:"Engoi! ;" (9r0amo3manP"Spirit"wePP"Di ity")prot9(seЫ''">Arklmukh"SB`p"ough)g2XIinihpimvrmre*8awad//>Sx`ieyBoPo1orF2|left]g8Xsk9Ar`weXpasugg@Kchl0謉Ё:0ina@k|hdhmZa$unhlypȭۢ2peeX); 9(rȩ$` yphic RacȝXycib`rophIsaiahes ]"!ȵ0@mili`s"dust"a9:tiXIelfraA@ecau9鹻cIyUun(p,y(nɺ:P.videntHH܊samXɸ=in>"KeepyyBaa8RxЮpyouٟrW-o. YaЅq a.ep8qu)"s."oo𡡴l AQHigBsilp0dia?YXq+lad@Җ[R,o0ؾ`l 8ٷos.Ԓ2fꒉ)hIbQsir'_Zi2midqui0k𢀤B#ora(doG>"ɄmcidPm dw(rsety񁏶(edH0paяosoXXlP; 8qȡllsXipaeopB ift@ssengb€hag:pstYcons񤓡0riddlhIsOk8gihw| 0򽹌jYXTserve׺>"O8{Ianeڴg8lx8ttwQI)fvory, "zinXS(د8adrؽmRl0urvta:pҢaccg9ocriromheousefhadows.ne,"ndpointedorkle, "callhiryBdecreJFat0aerfafar,asomeqhiddeniuffdaningseca!ingnoranceroktustom߅߅mwho,iWalso rescum,',#deathtsɋ1Aba,ynemie@He (ould0hiefpeople:SheltPdKlytrovmurw,utxverthrownBIsa(hisfeworuponnaؐɀthPweIᒃVoic(ꍐreturn`HrsellordshiprightPSorspanotlainې񒉖XservantmhI[ed.ΊYImessag؄stakeackrcms t8Yit+wxBride.ɂDa@thus,rМ1MinissP?"

"I(answoneevKane8attempIno`nial.xsthartumpanactm9}pr92nPemcatcrwen:"I;speakjudgmɔ;e liparkenoldylt؅tstca8yoas`dw,oya  cc!oapiesoulayxor.Ÿ*conquҝnxIgifJrbcB:pla81po;sر(Xf.ԏ`؝ay(divisiXkenduntil۩r.s舡H bﵰXl h膴9- ki00loHeaJtPn(rHisp8ѺpassK'T:ێd [desialasP*r 𛫩cce1dmmyi8ndi]il:ag@{volu AK7!Ђ٧!h dЄ"4c8nȥxjgiy7Engoibe@n;Gonyoracle;!fh__]iMbbegun 3. "Youj2bec ׼h) cuyp89*hw">H wu踛ws0Iq!,In1guyenbHiy@commxQ<.μPdid=Dd餙ammo({arpѿ@xjreh)sqsleep׿>"Coh(O2aiI do Iom`t¶L Holyfas@hwymqswihP.ϷxsuX.Ƹ(kn1?t̺rugoYroubHFнdh.oY C'DdtruW!%Й*.ayhapȂшbgpdoloss.hoosSn'QchHrklLrngH)qlhonصZVhurp iff"PLscarcest9unww"Help8h欳fecs읐limRto zltsupportmbm8zeњittwaPye1jXne؞`(lojperx9caȳq angs'# n0 in0yeveryhس1w`9uponeithuchntensityhattamperedyhysicalowers.tengweeachHtheltarnsbig,olden-beardxArkleanknoisneeseforeBgoddess, oyeld(r.

FHfirstiIouseeace,oughvenow xoolly0causbackasAe.ertain`@utiful;n@eaturecurvingiplargeydarkender,hinyuyivorHallofrowmassȋlhailowfromnhjcoronal(., armsshapely@rih@hH9figoo,ligirlishryet1dignoborcommPXhimmrobhfad wstuffk$1rmigh)vɐPwbhAamsuggestsometH9familiؖouryldGG>WÁHo(,xwoebbloodh)p?Pab,gyptianParn?nrarns.ϔ؅ځ9ɂفr)nanamw10o 0udatownwhxip XranhD*haraȢ halcrosI:ɝ;R1\`qranci(eHt1welaap,ut򚠝:# greetBaQlP.Ԡ1rembl0l pABooped;hwngu03acc$pPhS(0iyhc8pmnXagАSaЅBʅzXohߪxyeqdoubt!//W|evixfRrcypsebegPspeaQ Hajm9nvoiϰ%play[soHlPIx)@diffCK░Zhixm™奒kj)o󝘹>"Wilourоeop!pordeO׾0r?""ask9p0abIadap٪pditual>"jİ3aldȹ(2iPtpmay,"Ple70dثgS owDDLOR+PgCEngoi?"??"Ly?GbH'hYki PXf踁98Ǵ>SwqwiftȫetchP,urAl nXjI+OO>"NxfoXd.o>Hookpr;(9HittivoHsٿtouХ1brwH,ȟyo},nexgiHxuy.Έh3okaIrxiqлy򔌼*Z h oinIt #urotecÈ\phFate߬/">T)a`lou9 *bePQDHadigSSsil2Ҩ01w8ɰ"BekzBeh!hknowʼmy8!t²9ghcroнmptiCy[)gygonY ImyYd "`sec , (isdću1stxdaYƿIlYlso,wpapȿAe@c؄ARbelievRcdrsn؄9ڻnFho"Jrwarnxt1canмyaYde.ē"g˗back, "$c|`mifnour,,hoaveiskeduchlreadyillhestloe,ndfebfordie."

Ssighed,oeeply@aterleram8hooks0oughthjoyfntens!liefayingtbeneabth,"Sot.owak"//">Theለudoiceid>"Iwearyselfo4Ohadow.ostRTth^me?gg,"ehgan,utor8bmomentanepleaptpon)wifteopard*s+ack.suppo whiawatcmarkabscXdescribI00lipppfromisus.אHadoam(uyImagitru@ngqrrengXdIoarry*offohelpqconfederatemople.rXrhiP!miHkȕjeasy јneArimaHman.quesp+:mamazdthZy`22;٘hnx(bPurpberecraccomplid. 8sXe beliX8aston`1.rkkevYfuProdypassѢfcoulbIȨmbIstancnP3@d0Yta(beЙte-draigxsImflw 2w2virЈ{3l Ina yiarquickxteri@oagu|lxeyhYtٗ)bexrnSatio`؍BlargwHinՃЃ$firPNo ؇"y2,2ancjdi0rn;jАp`gopagain.urӚhatҠA!fix0 ËsIPsawcx)ey ! tral xllCailsowl-dO>EvYihimm!faphw@ټ0d)1itt`cryztklpechInciAS@dYmupz9uhXbeڗ!)=hreplاаЄrH[ "kɋrmH̹hp`3xclai>"BECCURSED!"effa2Ĥ9o@PJie÷вqsSp0ci8,les#wo)ұaxhž(WpyyouµaرopbeuaPHdeaCal ervsQïshockJi0c1ak)xuraicau9y mblfupl𮡺l?ɍi,jwxjhѳ |bensscribeiriנ>Hha sudiwbh𯹇ُRlįfoHwofvXnt,Y0lapse;p sookctu:smX_9*bplefhiHohr0Xex"low9ZX0pIliasboȨyxpalt{nising(m>IX fAIm[ per`xJde`?宸IP`yJPHfDmiѽAmaጙ1bAL0rob zawhoHl@oYp`trupIiaYArkipugg9fe!0amatiпۗԙ랚hhнjceih[noںϽ>"Whereshe?"sked.

"Ion'tnow,"enswer thinkomenamdookPrway,uttaslloonfusedcannot ar."Thtga0ringrokepumult.umpana oIsscort8us0w3steps,rkliileanonyouldXexpostulat,oraturHynoughwiXɁllowSha,hic3i0ow{do.tfo@of/ȋPeparaH,behelpoffknewweItakbackBuest-0se>"WPmeeomorrcaftmXIepli hathosꑪd蓐indar0ss77>"BaassaidȔsbegaondr, "Halmitythoseba@catؒed-BullOghyarily>"FHtwoaso.f0k0 v`sP8tealroubl oPw!ca tia攸api ')b.ouHە5biteyisendssleep*days hweekpunH+nto ilsuppoѤP 1egiAnkȟ kichbe0 buzziw@s.ell,c(wa;h!pretty-paPshimmadhdrulbep4ti@cHsacrificsIT@iro">Npusu0Sdom'yni`m``etaphorUndpȬ뱉entangnv@ˍۧ)dlay8hj(!mpgooirth#du@iHsumabhri an?Ȯbelo٭HaXautifulyxcimqrdpȃobduYurؠr_AeempsX;if8z@e.âãذcaladɸler#advumi)ex+ succmatrimoniȳ¿YKcts?ĶimHsi*HRblqOncHQum(mc>M`rrid)(ʟ@sfbsc1dHe(u([Ponon1 c`0name9h( eclaل5ip`involYai8Bcertٲxtysoonst ys@H 8fҋ['ifYwarnᲹɥ@pС鋨gh2Jn܁st)PjudgdhminxPXxividؘ%ra£d"xie)worl I!a4siew caSu J,pph myj#IiBz,p ȥ0elfskaˁ d߯"O@,," d. "Icퟳo&@you|p@`1pl(,dsf@fanekagmurٷ`@es`0@萡Pb ȹhp, "I?ooeүi!al sHeHsetq(ȴȽis ,UQ 迈hinpewyeepgox)R\Bo`eI q"yTl `iddѲ؅alKs@y0o ŸbA:becalو0lancءeҶ㿨undАuxifxsWA8ʃMdfo9 ext"WhxYݴ`/ste1gؼ,Qv2XlIempbox.н kYbpifficult, butansouldanagetllorou.riestsanwayseought,aas,ndsoathsthe," Padded,pringoeryinnaclefmmorality, "goodhristiAlikemen'teeortHEM becausseeyav`Xdoithdevil.Ӏehge腓richPhappyqeH0ourhves.u wentn;aighpisaic(reamϊiR(tsnJ.nlesdX"0Ѝ8r8tenup"9ma@aarga(him:goaethatAHs."

IidY􎨎rgu(:-hlackrnse,p`assumqws؄peak,uitHБhBImI(lyaid:??"I8gladi1䌈s8an@surhi8IIPwhoskin.ĈheaؓytalkDwar?>"Ohe).rombenowl-aneh 荓L`h801r4reWell,ۛ,Ab`a,0doћiwchan8Da:P9,Ddfulww8Non`qfiir#trus(rs;smagicaCjyl wheengoiȌcurs,owl,ꄁ9Hshkickуhtcr(lainu8be0BymeacarIof0helpf,;nubk?ԠY\shruggPmer[(ǝkѕsuilconsccekuxrrK.h(ېݳXڵ f=]?ѨjWhp-Moins@8 cuIz{doz+s׫_ҙloй ]xna`epief-to-b(lЦ+tѧaccordtiaw..l_]ds0@n؁aer oeӘxLad˰me+fetishxsin8rrophe0;n2lA PPapook-peo8;_Ytu豪)jatOOd1spДIാoh@qh˯e!readϼϷA!BIlmoG@b`crowqlow,%FCzuewp; deɴӽawmHlH̝p@0Ixpec9@yQ,m0/+Assual¹quqra;1H.gn="cer">LAKEONENDHEOREST?=+2"0lor="bkb>Af`tumultuBexcitynɛqpa yei8wnPqnex(0dayrX)BX*bP0Premarkable>GratefulnxHɆAHlݲ9lojn(iHh(IPHdeht1enjoy@po9lei"alimch hot81whoXci@.t@ۂXct-Qpodvant(ѯI%ѴËmAnlo0ӥ!Izl(8rlith.umx3memb%CcilYfrequ alkgPtp8manat8bnbo z consatiQ idiumsm;״>toldhatanekeadscaped,seyaip"byakingimselfnvisible"he@inhichooubtarknessel؂ .hergone,{wnoture.os!ykturnxtraitorndunwayoAbaougharimsnevereenardirHsy.π`eight veeowRountrIrmeyp\wdea8kill"urse)Engoijdithink1sroba0,(befmagicia0initiatIwowfashion 0el؎wouiid rlQXliest s.

MyquirHportterHalmo8equalXunfruitful.askmisar coȐI inm!know,u ~it "[happoin">N T calaجI0$YaxresultKɬooeas:Jo H2zlxlxXhhab*پnd}bbsciȽflgrazgX5b@dc0 amregoatxyPtruoožep,eaxȭbsKr༡ha stricsժxnhextraora؁hnesÛsuة᭰hsӟg@Aga2vatyĝ!ai8arm2oUexWWx)i0wonder0t `)moHAda@hEre5`EGa@E@.gKuya⾺xo)isܚydbesplm4UBbnmolarP0d.@{ȃinقholt oh*PFajAmbrherlabygy@@nfirٓ Pco]1DRa(li,{d(hDt,}irJpx0bodH{;˿[2happ((i`ww>Iۮ3ﳋbh#!ouchesinciykyoagndmjQfu)hOO>NpreferCelep0R 0sidBlKanekeeacoolvEp 3progenitoo9lqͺ-ed"rejsle")Ջ9iG@mphiefacBmyXryǵ>M;viewx0oursP(orersa0)7bQȭxr򚢡!Iu8!amu0stiٱtar-shiyfH`bնwab pr୩4PZsaHhch)numb:oڼبzPthatteedsoeupplementedyheleshfildnimals.mong Dabanda,owever,isaso.

Theirertiloil,mplyterrainxdtreams,Rut}cratch`yiebu`nt`cor#variousootsegetab,hAhnumerYflockcherfurnisqallmilkme`hequi. (reforʀ0noxcessity mᅨpak2ist؋huntingPithesuloseas`cyЌpilled, pycourptimeaturycaboQaci//Havisuinvestigation*ntry IXmapproaolip0H,shouHexpl,9biddexeseiz atesؗYԌ9Yookp #sLaMone>AtrstلIpPmat@,umpanaway(QbjecqPte3dafuPmoo8JifIo@Hdonductȟ xgdВʅighѕ9lddat\wJana"ѡ ,@Bse3A>OIIꊐz(1horafa0tarrاPuhܓHanRomweavYhinIHIngH-poinh`usSgoBo@him pXmarkinfamArabic!hbe(cust@ahPri{se(prs>Wحfiminute l9ablacknxq[mJd0n@{㳘n;GaקȔliaal-e.רreHlhel2soXya18mp@➭e{Igras ȃ9incewelholCP//I0as0񣆇ISy??9sw(isdknowaБbIbpa9unɾ)ce"wr̘ rungi`eBki!KhadHenY؟PwalQɎPr꣰yaۦҽwK9`pa,pdevoȁeafhHгм(YggHg⨾㾐apu begu)"oo bX,smoXVdoubtcovYZhyinGG>OhȒoliѾglimmerYh _yXyuti(,8t(Y.ӫIHildfow`ifa߱ccaspaloakrognuntP8Poppxsalڿri,no!smfrequ@;(rdirṋKing;I@de@ zsemi-savageH@m@HhauhPFhaI*is² 8pS0sa d@L"argI0msdg;KyХ8HЯ!uQbuP midIhwMP>TakimȮPsYHYaGermanд,9fiະ88(tudxaɭ¸؈xlp|sculpturHrconsc ҡtɫ@alab8er8`hrockkmarڿbe)mgP謁certlooi:yhalfruins(rc1cɲ;tytoty0ffೠ0my}knصAfrica,excep:IZimbab۽wweHct(bPremrempPOEgypP!nreenxceptnictures.here*hatighteylonates;7wallsovdithrecarvingwcourts;pillarsm,orndfne9`seadXdown Xne؆Pcompleted,2QglassesɃldcolumns.

thrme.aPtossibl9mysteriousuild⊀cyeo8romncientgypt,xn1someac$afwardr(dotakHirrchitNm?owathinkQi)truncpyrami8utsidtwstooQt9altarpwhicfiPburnsugge8issoWW>I YKumpanaquPidimlosely,t XwStell yittlH epHȓ)zisl"Clesh"n`sons'Haldyplai=underțtremHfᐸradedefyiXs+@ye0֖8nocor2ccj˕whocRishJ%yPrkdwelrNotpuaadiِved!an(Lna8qYougerhapZculp¥To8mdqwoplucے!'ʲ %+dx*appྐ th贛reqg۾|beli(abȾiIquif)ʢ:dſȪ³adKi`claPrPaIrArH:)ɻdH.ϔ_Ԝumbkept@votaRYjoy"inpic@irg3Pxٚjc+"v *">WhalkhimȪ0b Jvul,xp@Dutch,"Look,aa ,H!A2big8useGo">Ram8lasscٿaros!h-ob0figeHgqgPwЪ{w`Oiatixwwi w0`yw̩!odhal)PybegweepltIј00¼HsnȬo{!slhlydz>"WQ"dHg?". "MaBofffumoon?>"YL," Kumpananswered, "andhinkomeQgore."

Heasight.h8"",orresentlyȃnnjcralanoe0owndiftedhiterapxmchqystverprow,`attellhttHwithlargeplasxvanish8Їχ"Isaune?"askAgainw>"Noubt,ord.ee,thloPsOHʉbodyank">Tqhieply,utgtonausuncomtabl semyinxWbfXa*opveilsquick noxead? yofpri@psacrificrxecution?ȓIIaht`;a@rwardsȖwȐsaw’sh8ruggl89XIidɊ(havpimaginaIߘ>StiXjusines[eeriemade퓐hix;1mu8uIsorry+turns-hДpsl,deparsXg,RvЂ%sa8qti蝁u:foli!amp0Igo #wȢ胪unhoabo2!lakK,rfantichild fkn*inhabdy-haunt Rwh@off`!tfumoonȘؤoldgyptiAm3dI0liPNrИXr8owyIumanorpsAɘHs#eborٕ`Po>We Q|suidsՄlpZreeper-stem0hث象C8upour(n؏ٕ̂Ȝav@anh"a*zes`beAny(,xsuppXQnnctxvYkyspi@IconsBbepeakM({loudȧeca a dchenrpټqsic">IpXeً@ȻdetailRfur*sd_aba{صtiCXtXYc*sȉ=Dutch:nŏX87e{uZp0izneasu)mncBjZrubbۈi`zB`ein8n`Pbuglwayrgux0,Hmb`view#٬opinᄏ,romane4d`yicula`Bevi">prpo lookiaremarw1rn{zIwralkᘴ7Yq\򔊴:dshoupbg鼯>T!I`ئrexdisashimЭyjp(tryolXwhȿʪiH-d&࿘reaonkechnhl1ppla؂[2eporpel rrrougmk`ruts>Apȓap؇9jH e (Zse%m1Ywad2ittlwam؋)(rew)81Xf}0arenaPcopsy:oo"I hyout,ordacumazah話ab ofiul`J9."ooT9madѥ4r.׿IKPsduc2Chri@Еp(xmouoppPmuhțmo-j1puff?er࠹ . 鱀nu𿨨7omb" ɮLcaspk[pihU1aXS Trulybelix!eusabeen(xcitqualityiYaifforesxexha1perhapsyZfoliage flowerscertaireerHsgrew,ӉpointxkiPrpossed cauxraqbjurgqHans,(ggmbe8noughoxoaky\'saȑvpordsYmPh튘dpoken,x`jifyڈ,avy fghostmagicώ>JhnaafxbgowЕZidesc`Ҕ(ow9imoonligh"Pbpaces.swroustumpr"Kanaurnag8y:"IwayouBAwillBlisten.hiЃyngIln."IPp ituckHaspecdhd.ΣoiXee tlije@yxjr, 0iunn8whomPaccPH8ppeIɟgr9tȨacquiiercaq؋anc`HYjgd`8tPPflicgg>Remembe8“playsE(icddeڞduast)`ahYAZr Ahe񯸇n(uwTB۳،)0dQ,(f PinflueȫlaȲH-gaTtc`ieì@Qvel³utt؍0.u(nbȉy؛H:xRÐbeȵRuzzвxrif8BHbackGG>"Wgp?"asQ@igȈ0cc)X0OO>pٞ{@8PI"LetAg8t@Cy,`2gh`aidooWWULeo&In'tnhwaycaurYdark/)վr !îdisнesultPB˾pgC@crash-[uPmys8r.ircum02Hlu ieswampyaknexIcimuo"rdifficȄOm䉌 @s栀ja`DIkakf8epbecazz!rny^6riFኔ8gЃ0!`waritЫf92P"Stop!(w)upposHeRҾXernalfypÈ; lmɭ18ell:ٲ>HroducrboxǟualefhagrL!1q,ruIˬndɑ2mAkmembYichșadi!lbK¼`ur sair.heniftedheatchoyipends(didomethinglewtut.

"Whyyouoat?"xaskpangrilyfans. "ArebafrahsettYforespnire?""Yes,aasIeano.8Jn'toAonkeyut;saIsgface,"eplinoice2ugghPwPfrightened>"Rubbish!QexclaimX "GivoHrS.?>HebeyrabunwillQsaʎQhapp,xPubecausyeaurrenfirhiXpassbetweh!tree-trunkpuffs>Well,Qdessmokuddendepar9Il:wutqy @Besuarauypot. agHۓHisackmIgainmine,XpXnswc,palpa`eXؐtif 88QpxmbЍn8Hperspiion>"NbPtJdotalkamoleep.ٜXc a0up xdawnIig">ScarcepwyIwords hm8h,dipnctI1rder,uesor ru( ularmirthlesb{PlAarcHYfromeqr%k>"TYfoo@Kumpana,ymakfunup_ "Xsh rosid0fifXchimתa8o n(ieemoyZ XQP[񮢈everyȇYnce"beganۅsremarؐZloljnhoerrn">It8P٤bi"""eX0aboourid7GB"e8u8ithyenasuit'pook`.ϗ،wwou@*in c yl@l!aЌkProweopmوssn9vilJI;cms?pray@re ړmhop߶HѶeЦʾxFFiehelpX*i@7ࣈy򻒺QڭsuYtiHPmooxrgu黒@.ͰБrQtryembɎۍ)gectu P!echo@hxع ltipx@a(TdIawP[jrec˽@3selؾ.Dst) cl 8سf8aurзQfollowXphscQ!simixssip.΃rzz@P 𤧎0ou៚J૸?:Af IHPy!w3betweXwinederexhxpXwnfxh¸ibXtorpɄQpq0Ha\m{loЕhoRzcras:aPGmm9bharؠb,i(agoniz)shaid@ch odslate-cilfeel*suggཙt{n)*beipullkyϢ,uؽvoi6ifBgor8ey3fd8A3ьPI蠺m.as窆iflIpܚG e,{eam-be` Яhh9 y)'8bIan-shotlitsdafhhy(fig0lfantic">X&ȧ*m qnoivis ropriXictimd rium莂02@soAm(8YwXPleng;qes`Arabic:"R0,acumazahn.ouPwؼromp@Binh1B0pocgivesadreams.aveeenentouideoundArrvabackDaba-town."

Ibeyednxturrypreqlyeltsofleadingeknewothere.rerhapsshouldayhI8oughQit,or(dareLisasartfeimfrom`ichoubtlesQsuffer,seemxbedIward,ansl 9myoat-tailsikechipitso8r'(kirtshowoPIan)tell.llҀ`jus(ieXwnbkQwouXPseluponedge=XeseሐHuÉtruncatpyramidburnɊaltarireoi01ȃDAshadlatredee8'yhvagueglo*saomaPrapp;t؉Ifacefulgu77"Fw,"sahwithuspiciH8mockepPoic@omeYfliarHdY:"Yvwis Macumazahn,eIHX,at\nrwiЛii wAdo* erst#raYpowPwor@anciypeop(QevPSm h8d__">ApoЌ2teqy q0 rnil;8ouF0¦acc؂iBmusicalrep8gaOH!nP KpBaasQ1:Hggiؒ"in missiqW-M@lif(gaion'{fBlЀiebald- +ɩIWQeHntry0I1lisa0(qkiٞhyoo2I fbedign="cer">KANEKE'SESSAGE+2"lor="b@b>Ix(w*whyҭsabqArklilsto@`"(кnaRed-BuPbecaѻ taurinug8Hngth.ԃsIwսl.f[(arrSJTq=Lake"pnսdisϼKane(lad1A s"capegoPׯRJews,lAupPhidChief'sig3Qh()heeNota@Yillegma@oQeʂ)ult)rɸڦ:babubsequAtramp-tp,efak!spPDadocxagici06yJboscriQfollbo@o>So"s @lycЏsqhelpa0ڮpticriginpysche@tshopl]my𫀎axg(ppiecɝvisimThpurpox talX,JevhmenkrttruhѿldyUhedrX ⺠moniahYEnglishhnȁ*i8,uardx80С@Qpris;ro8phoeftlp.ψNRnplangKJH@h\y2@eur sItf`KwypassymxIjark4nowag>ThIHwayp߼is8x zo,hink*.fɋbd9pycSlargeyfixup hQt(;0XstбQcXmosI liڣy5oodruessedheeaningfveryordttered.hisidotenoromoteanconsation,ndeitasaralys , ptast uc(meattlIabouHwearoJtrivialubjects.

AIuldearoretakJdvantageYtempora absencprieonard,(I?hXhanlytih`퇨curtaiIax0right, "TellH,r.rklHifouikffe.ـseemibeHPsoninႨexceptathoughyȃ ahief.o`nkchyosi Rahiman rpbr 8?""Nodon'xQuama"answY0thig. "I!bu,PtkpIm"nЅsp.Qee:smiyettru1sgoibeg*PsereamsYLonaenkixknowom,wnylak}0XcHd.̘Pllegiaٛ(ᙒYr*fɓnup2latm9tfhchaibrokeJ!ship)PQX;"sKat'e 9Pn!.>"wis@km?"sk0OO"MQaemyiriHphkwshoXR))muw(wop,ncostsك;2hP?Forgiv 8 4x)b#ym8129n:"honXWbНɋ߬'Tiuscx ce 0adnh QhahtoQZfaЋhoqʚo.ΝHaove-af!\/闉fc*!rriqxwexsomxme sӰtaulX uB@Ubiggȹ`ctiڔQado0HERÀڒliꥨ.ƴX̽x`pj1Ѳ"wileP.emembsarnҠelfdbeHaltar^⾛dPHooZaQDs*I'gP(keet;b I˒n fiyg#it?ؾ0wXȔamxTKxargument:saiAsur`۝ sassѴealiX ">HI0khc`-8ryprъ`@quq賸exlisteX8)makpzcou`fromtivoH9ccompaniKuiفؔx2iwheɻs(rickYqyhfollowڋAIlabl9miabl$usual鯨dignaspecih`%Ih+Yr¸ervtcanywal\dG>"LJ,~. "Y8evi`R lefhlYZnbexooџt1wo f@dchZ8rpeak. p!bYhd{Mٕ`aran2bouhhelpʿyPdH\Pº+(pd QɔouslyPRsIkHyZGD,o Macumazah I!i@@r򮈼x@Xync8hHpunڍ "YouHfrezgoenwill,acumazahn,"ٌ`"but9aattempZd(oh timppoinH!waritZ1greHrisk@rself.""Im"afrax0s -!"exclaȍmorkleroke,4://"FGod'axdon'@o,uatermaintopxloȎ9caKp`pIanish)ght meanAnxioڕpc ⌓yuriositboLAMXtisfixupɟwQp!etrseerieeopwhQps ឈl؊Qi"trangun5acaqnervhimade ibeliarunkar uc! .Pfe1 Ɉaiugg0@hetweXaini9convionperhapd apimpuls4associXؤyaniracCs{`ev9pA Plovelmysticio(@xPsfaJrAXXlthyʒ1tl˜P0taymyaH2sn;Icirтa11KcIХrs.עAwyfhurpOy·bar rcivilizbzChtityprot{nroadmev@Xcengulf2dark` v0ֈ iworflҩڵP/`bnwpHкܢjXfн0al dy 8naYrhiefώr-shipp9Dabaweups#1,b$s!norZaspbiplabIG unhoscesacrificmay8Кaa,Hh(rز+0wnXnrdnmo`sٯXmqbeyolstW>uddIviro pPmind:ۦ helضie`rclcbeص3s8oؤ9ғ@ottomcIr-lH-!eek[rȜH0ced*omѢ;oBswful,\ad3ndudllon1Pesp0ȫib0escap ºHg-xuerr@th1t(|thbzq-)YsBje`ARhookRi`hQbe9yHdid:dhle>A1 2Imbswiftthrough]Fsu5aboú#topԬh2snؾhuoo;:X:Hu@asidӡ*ȭgw(eTaIxcognizpabe)ڙKfar1,stmselvArklx$nowck8ledHCZabeeo(ëӟnmų а@aty2ssag2deliver>hba0peakreelȖe)hus1 id:"L9iwarsunp,χFv iIshS~0S0ͽxb8IK@r1agoaWal1A|heesternasshateadYrougheipfZmountainromholyando \Aban"slopes Aplseyond.

"A9ngthaHti1DgoPnearearXr tcleft,raast1catchtforeQstrayedncIryoi,hi:mnotollow.Ԅhdz,Hinglful,pHa sTqoulxea,9was 'Ëҋ-lxϊ>"Here,n`y bordlinsincrdar)pursuFcall(retuxus.tnewroic,comЊenudden`betwe9appPrm mpushes3 mږnanekwhoؐ feitIhihbqc"'Stayillrlin,'sai'fouAjlwiSk)8.'otood2en!:GG"'I,ubl@BÇDazShpShadowwןwlso.ٌIvBgeunAoneule twoeoplw0ividloagGoAˣKumpanР*ir\CXcilPsphi퀙e}Prishwa fihi@HhUm⃰icraf^pri8󅿌daXcrop!耡ow˨similksngs䦐uphildrHsk die.'//"'LpsixysllsCpr@Z)`;thous@-,٠s(Ȫq0 *acٸJbe76ap.מDanqypposep;N•ԛfow*guHll7.׎ev(wiz0practiseblgics"d(-dwp8laaIԀwmwovҡ'beЌagLly꽀!!na)W`LԃRed-BullLAor(!fSmo%hovKH2Qaw`qB;ipcirclp1nt sqq reahrifatGAWhX{Macumazahau!I蚆ma`uy qbXH`sbelieve8b1or Thenstopphortoonsiderrkle!whomnoticaurioushange.ewinuteseforeeasookingroublndnhappy, Peashatayuessed.owQhadriskup"seemhquitePeerful, iaysomenglo-SaxI(`myne pm)8ȅprospec@ffight__>"Wadidouyhouleᇸget`ou0ssuapQuatermain?ٌׅmorrow?""Yes,hthink,fwillee rXelsaid,鎨silent3KumpanapeaoCanttellroAresttilsЎ>Hydepartbad iHummhCouncӐow, ichsAwith`rvQrapiditfiveJarrdɒroom,0x 8sevofws.upposjy PngSpi,v1sctؐny(pa0,owQoLh`npgnMre0b*xtatwo֊asurm;deG kn0al`dyext ajwrtКPHn ygava#8l( carcheroYecau=aH@overyasusУڠfamiliaYr9fa0 =;pmuattpiAoҤx a`sY9sidvp8r쨠\ol. 7!finish3turn Åqdefhnin 9vieб"Oh!btIananek1&:emphasiaddX, "b(fiacumazah;ሙm(n1s./>So75!q B0lso̮ؐUWCert cdnyblsKH"i. hQ=w Iar3decl,"a2fئ 9ru(so.ǩyQw\Pnar">T뼲uIଉ˯8y2xkRdAb‰froÉ𼸪uhcAfiXǬؾ(7QSU'lsugg Paccep Hghepc(ӈUlȾ1gorthycony˱submi ngoiKL,qiis1"Doª⤀bg`ho8s?כy-2񩀞Aio!mHP8rięzyP_PI(llapsaIhiQrguicranklunclsurknXRavhopsifpo(U-mak(>N1?ȭokHz8abl@SkFfloor,aqazXhp:oo"aihimself,9il!Z@R;j\dppo`R1A"ro竡hsd o` Qitw`whoRql`t$9yrlhظx-lȰ capȟy*8longfdlc)p9aoncoͰ0XoxË9invadħ`hixjal0j"'!Ayok?"pk@??>"OheasWI twqҥ;unl񾹘wڬتZoyXyg` 8m<@bePH xdisguiseyselfsabanda..."

Hereumpanaookedtanndhisead."hen)KanekeomesoistIlltm䂀;pa@Zbeootrouble">Onring0Hcold-b`d`propositioЇHavlect ouriewsannounccoXy nowa :rٙcelal@tate'th@ghzmouththinc@armin񉸊.frAIȂtmeanpoa@9isla8!r mbeeidd—Ƞ@ciHuild8IlIga@onif{1persuadڟ؋m06褈Pp)@truhI`lik1aimidnijneь%8YרϨButaB0@m0odіyff8nSu韈mتsileorP(extraauo rdoor-0*win-places,1boocaalmodark.ԝDspVf(tw0"sneel@eiBh,aACQi0lHt,gAqRh؊iairchre"Byʎ,"nн2,2I&Pppmyp"wX8霘wAqH.ّCrAfricȂd,A`2apoAcauâRsxi xoloAˆysnew! un.ļXs:Psusp؆*󾰆yope,vilKsavag)nymilara)*uir0j(zul`ir9xppЉraXmkyж>؝saɺayirchaicnguh~MRst ,eAhoo8m(veIeyrBSvoc İsa olemXymseVqkeep"ikH1mo2!ead. 0degw某KIlaXb0nkpbreHPeph l!n.w–`ualist mediu!reflhi) gif»enabp)ٶyun,0HfXiR)lligyњ8hu ФexercQclairvoyfac(袤P򣐯)h  Ph__X†gynbodyxAfxwarI quir: supPumyi yʼHỴfa;hxwo 8anl඀mhaɇulDabayeXtribhXcutiXoffic мadv،/+AD s)eora{VoZddnityrou@Hطz^adX ><hichnterpretedhemstleased,fdedidotspireevennuspecx.heriests,yomparison,ayamall 8nstitutionfistate.orw0aminiature, survivalndemnant,imagin(whatnceade`trong`itsHyighliviliz@@munity,8os*ncipgodeo)ne(;@soarIuld rn)(n 0 owinyreatnes2mЍ`osstoreligiouQpu9Q@eg81cprrara(o)engtً@r.

refoe[gdownfQipeoAcpwor (oftdoer uggle ₀h, xsomeُarkInkNapol,rovide)iseemJb1{s;eigattals#h"adْddi:0!HAOhqoffehgsetar`Idoctors-tribXI;y9udi3Hadrawhoroscop,BPn4em,ҋoumenowledge;IXva+liؖ3Bxdictclip؎\rabaccuracy.lkept`cordh)gh(e܌98k:@m@HmeaȢsignamPrry InȜ scertaibecauȑpo@i!c@i`ctȧdi0u1xHojour m Smy䩼eab a:cXbP(qow1:Hmanifsߠ>AruXna@nItШcXonu 򜨐Stimgro:fXdeHtiPlaoyrom 0y;liki music諠hc8Haasqhl)roducupPQZJemi-hypЃX໨undoubJhymnasRHeӯڦ gloclRrظqfea~bodiIorpHlefPexm9 ivhappQȰPm>Iytȍ YowyNq겯autifuٔЌ;mZPooE21tș0speaX!һ2xmll>SI(d;qtoo``tchd;uptpeyaAwa1qinI ka򘱷iblr 辙limbYPhbvulsHokf,ijIlyZ9pXf⽬0familiaUpsapiq:"!pP9aЊ9anfaded>OfQrؿ؜aӼ밁y(rrohڷvyerfuI-ghc, ɜvntsJhnkpscatPYbI.eb`reȞhhYthжend):aoXyulhsuضepѺjcipǫxipch-cr`vineaff80iPsi8a`mod׹8up,Iy𻸁#. (BrRHto8a1wyat@elfBleeĦHs.) rawX,ubbihim aiduieS Hyr@и@r>ngoiodiPme(dangthrDabhp‚ȂYecXralXtwXusm`8,\1r(ym:"ReWexpaY8 Th`crypticessageumpanXauseZwoPasants0riestwXaccomoHЗwicWh8)u!yPdHP]laP,s$xIoutcȑȄaghQattachHn Hiculimportanc:mission.__NHI0uPlerppprprritat,rwY.)moisickXPaffairqsa܏ۋȘ!(`y(sospdoubtI(expect8hIi!x0ڃ ЌItщiquarrel8tw:x -se`ؚaribxʖtgXvبossÓojgifporr?Moreamoralxpjpla( un"r jdmAfrican(stomȯediXB(ti Ɉ𭈒!,(hHЪa$,sifqtXjҨ behi{warrmsn,잰pIecrcrueltygpabe04pca ifrDIدhoxbhappenmeArk 1 $80$himר/>TeHZruНShpٜrKpd4)PLc@re4si,IIoig0[yerveXjP1Zikali RBkloof1alsȎhv2Nѵxrou@usiMiЏdoonatubIawɾl؉d0nXHQ +m8keB\@8bdaQo(9bIoiIZpeep Kwo[ os.ȼ`Dab8a-lhP ́Ќkoh (I8agi+*0R9wyHaH"spooks"q sel(1Pl+ٯdesiY"Kua,"i@"@ XUypeopѝAJ?""Y"1ٳalowJĩ@epmi"#a꫰R._>"Tѫ W. wf+ntho;iskxrcoffϹ(IKm7LopMacumazahn_Y. "Hًw|Engoi@Athendubey܆XA1yi?Ը b ;8torٱuwㅩtr l.Ѓɳpn1bscappS.reoyddquickX 堀PisfaxvPHÕ$fhne"wXbIt?:: ɽٽlعpiȖo'mɃaPe.A蜸gdo mr.ױxn2aht*`!k,n  acceptXpaymromanetoomeohishuntryndotleavet il8ebjectfouringascxplished,aymentnvogold; weelievaLordacumazahn,at8reehonestanholwaysulfilledprses,speciallyxen{servicesadbought."

HArkleo *redit,tXensharply,ay`:WW"Beil,umpana.oul(sulru1-?>"Thank,"rok8Pnng, "butcxlookfyself.ePllntePyanowChief)peopl *ImLjȑђp">TIaddress\)ow`anguagI(on."Yh:informed.nȐietend gre(rwarsdoconcere.orڅyargaHanyaneH](fiHttl`r J؛hpb0d.ԝbeєitcrlwithomPwhich truȊr0СQHanppˌstartqFuri,77w랓bأAba hqyhte8.o2Ѧyxso0because`1su`fashio@Ia iv.e)s芴ƒSɂalaXt;chdholaaiustom1becurio@umexIesiRup*no8ud;2>"Wngs*2d뒀8t'8""S0lܣ{e(him۬И`I,?9H]d@я*0ullIHet`ڸr8,:asksȶ8ҵ70Zacae3#1@Beacxrr)twrvant2d h.ϯhϹɮ׿0c|SȰ73?hбȘQoѪ;ht"z`fin@edIyi0owdep ɭиipSRhelpgi >"还L @w(ڤoi!"xclaihpmvoiw(i@HhS"PHw8@yfЭ;k Ӽl,re((˙ȋ$toӸn`tuBArklYalso4Ǿgۻп>"Ofrsؾ0 n𫙲ؑlghopylp7ailh1iQu`rməTxmd9"ؑ@)t tic,* pmewO>"whyBstXI?blhWQBI;FH0f耿@mXarmSmٰX:n.X$hnd" (*rapidY`)1qfbk1o 0x(laЕday?GG>"Ye8ڈbsorryzHlia,mY,xft(se׌aas`0sidp"remembzpow-ro`ad)cateels`xzarbeldf ೠnyTugele9(gethقh`? agoo8, j8duɯiy!)y :shup`),ptaªCaf0(Xp`Ylʟ lik yed-Buā ladȀb Ihivered 8Hans'uggest Hustrations,zw:"L9outyootusoo Oh,aawon'tIbecauhavefou`high(ai(oatchou.uckilyre twohadow-ladie8Ӊႁps(oodthgit"lign="center">THEREATTORM+2"hlor="black8b>Tehingloudsik8o ofHoon(gan ba(up0ake-0B@ctry*soar xeylee'Ta'yqa yrain-doctores"aid. "Youmemb0Kuma JspromisHyAdahobdnerreeearlit@.owɣ3}go)get ntyenrzemHar8I xiffpntlyg>Certp3hHs{peculiar. țPat,ibehcPiderabP!someaysȈe,xwrewtense;8s imagi8sartiȐ mЋrb1081110eessMJ膩Hopp鬩charac;ai `cdIelt+oughP I mI 9ʄht@fXbur!nfi spiS7W>PIyxmyPptrippBQihbdraef؎PCgasaxsh (wah,ay:TPorm`a*brooln.ɍB'osp(`quit ,`ټОeuooxmЍwexacqu8tH "ocal[kn J|abo `ergogen`l½f@|8dh.enc0phecy1XfXincbCyilQT,s@ xpl2n!fePcX uly{Da;jgҢPc08(rvW>ioӛHot(totsoO Lʱtow"ؔhcreturnєeo`Qw0G@am.ӥY:look$ roofUx`seRi(drivABcരhȬzXc9Hcarrrhq ㊤ibasket(Y(dPnPbeɧ*RHservicxpritooP Ѵengagbua 0dpalm-leah:qlt`RȔtmesumPxYc"futrҼ8fi0sedalw2+tiimorialϺWPm atadfulsleepXw`JdnyKpPw࿘@ntitHnixesub-ac)pluyfr:wM+m`9refZnkdafoyѣarٹNXmbpILondob0ye« nf×eavP>A虢ДBPraacطChief0Ⱥ!a̶_admiXrd׿r*.IkkagfeelsuPl1offArk YҿluzfexdѫJYcoipsychologi H0iوkrdescriptC Pxpassmh2C9IgliӾy/stQouh:pohEnglish4oodheriftfhem,lsoXatishedoersuadeimshakeircklesndeuclutches.

Whyerey anxiouskeeph?ond`d.ftill.oubtiashm(verwhelmingeasonhichwouldotveaPAsd(oday,8inclinK(iewmainlyL!actuatbymbition.ԆЊwindXg,ut -riddenace,esinceooecaao`worlhTcplHi2yustdՍHnumber,co!bPoneɇorporatthsDrilebaJru`anfor8abilit`hostooartciv z9o@ w`ArHbroughtM-l,empibai0autiful@callShadooa `mysterPdrawn??>TÍpexpbIfer;a Hsfoh admit,ause prepos0:lady simQsonaupȝfr(a`tistaPȁlegZɠЎ)knowgzfutu0!p2riadvish.ryhapɇ"Z(adictꞚienophecsoҗxmHenXoTiuAfrxn0op()su@<(rejtO Euean savnmiobsc!g☇mЦ, *depmѩאI(⋈Tount8lenaickbr𮐬Rou(QmYgnm!jї0e"did۪rtunP?Xhq3dqu`(;2 Phud0lkQstutsrxesphYЛclBKumpX竑uiupg( ➃beli9QruHdsecrylllplotٸXItPI  p`rengHnroн(![o iggaenAconne;wit luiw r-rfawyےww[ا8ͦȖ𝩸oo2aknapt̼hno6Iunabxfelo(ngu@invg(??>Towar@sunsԱPseAוeivوcold:s;poxHavnres*rot1ď",Jxogizrisne8hterevd sayꐑ[zxٗJ̋r)( ieoxsioTDklћknewgX!m zto1ti#(xۈo:nIwk>ȼama)yun`HwuXm2`ighBocharPeIRphhrg貺`le+ubj`XȋIzgg<턊`YynЊalRȤ0>"You xoYͧٿع8sPhemm`,"9said. "CѭPQ)y."GGAsٵ Ȍ{IYhliogop(e9a[mixZgr0lowj ԝ(chwh iy.ϻз(Qtowhnbumba krrushzܿqdoubHs8p@empjqqeItebegnus-aȉporyxffaloequaggazsZsm`aniPpossb #lLJRX>" Pbhhhtbqh"Ӳ$, "mherror8ihurt @Dabpa2Q襢z:ew(prЧ;i2yyou,tranger,heyouldossnHrampleou."

Idmittehattaseryrobable8Xstoodwhistaring thisestight,erhapIaveennllyx0ience aunter.resentlyturnoescend,utumpanaadeeЅif{omePstior.׈As pokeearsou chcrnotike:3oflephanrHethryg>"HhouЍ(P‰iadYdrivoMone-,"saihanished_/>"SodQLoranswer, "mscc0ckgain,lybef9gre(rmr xthqus elQntwh0⊡m generationhgo{w!yawayߗߏ,mergfroloudAduxrL wn8appnousrunnrapidlybedmanyqs.@knewbe؛)obyszyrkXs pnHȐ `cert蜨culitiXhugPusk#-Fwith ouriadepȠqlid@dplɤ Kanec‘aQiXPV;⥒{rbeaeI8&leP@cfellow:o ,af(wsursu0ourmpaHaz hvQuu(rpuncee1ʢѫ-8quite朰t. iHobbesiЮadp,ꯀ:''"A@mag!aapiDug(idevilthr LشHo@JerЅhCpoolJnXpwhma.Ȕa2X,L)I`fiOO>"N0yetXe1. p9i@seǻ">Th(νYwatcSaj0ic㩱)rushi(oAa numb8stwfift0Qt ay;,ٶe@mq0YyowAalf-grqsػamo''>  t8woy؝@ircumh#akhipidG>"XsϲXY lypfzs'ay,BnreԷ[i. ;|pro@Dg²+eHnǿw>"Wdoouat?skaharp9 e؃ پ!X `pno,ǻ>WA2th:Xm{va+)sthesc32o }ps؊ beg0H,utiole9*helZntm1rm oai!uteȪͲ@hlor`ЪChief?G>"In;KuhMa azahnXe߂1ceiw8ep%0Xo?>"Pa1lagoo*b H.ouZЏWShghȵnqalnyb swormselеD(eakk"aba!us.ӬCٷhaks`wZbYQtemp`sohsojreчbxra 0wоacplscertѪRP0ar, "bif(nWohYLҺ(hinkׂ׸9m@Rȥظ)fik@oR0d;skX"Kanehslyproack`8lost. [arՙcScupoZtQP4hwilloteuchnesouxpect.henheimeomesillaitpon,ndxwarewell,orgreattorms `hiIuseekhelterhile rages."

had煹Ialkedoan0boutarrivalfJmys0iousldlepxtitsrd,)upsepimery`chnswered:" Baas,((PseasPH s;Qymbewitchby"Dab0azardhs thingb`gozoppiQccurslOO">Apoke "߂"ga号denXaifImoansouexacti@HIneh`e,au,Xsuppos wi B1w8iteestipop8tre4v es(IPthougXbisl(oraK!givut0ancpasorrowsprolong!half-f grs."Tahofly1ou:!Y%inish0ente 3Ҟ mXsolЄx/0vnhurڇ lowlaickeJfashiP3a@myisr񖱘ȣRth0iflo)rticlfrom: pv9O>"EXhquake!Ϣ0gorropsdown!"excla0&,uitennecessaadviМ caѢl`dqۚJ-way@lr)acrosettq୩ospaxwKCobus.ȢY0`bHot(an뱀4P*tsafrem0,arwou(9J2wHm߫Looksaа[yhdpXttywolumn-t(r!Мgobtar8rʷAw!be=ɚ߷qb`Pful 1⼰IjsʤڴkneisY. nbfdcr`Xiݫᵨ>ydesced7>)1 c@edدbyXgsucceed+P˾xawP0lQ>nqXrasuHⵓseeDbHliܮgDõmolro(1elm n,y`honu distortsudPP upo@ furi( @fhysem)de-`txic`uauPrepPpgoin telar襡:ӧarknВ_Zshap9epp0rx-HنYÂ穘)лlpaȿaِз"netccPAinuxlaiIklacs˧chaQirpAxfºjX俨IÒ2oȁׄz)Q|g}mPm(RG ri˲`aboȲiThIPxAlapv0scȧpdustaDrockl8qfof@zoi1.yљPXh(rb`!zexs)ҽ I!h(er>lenm =Afric 00rolif LMclaimpcy.έɬH#el.o2sck`ZxiifshotroTBg Ouo#shaksMPthqu(msti conu;i allWIФxli XP,X)񤡯vX!row:huر(IimPofbeh( c0desoH.qQ`r+uyixstQ&baǬpawJmanpdxش(tӂpR1GG> @195to@aͼXlߛڹctkprothiT thcruKr0varw8exui:™inDabaeopȸespeciȊipstMȫdlugһ"Iɪ! Pprb7y@yonIs+k"Jow|\l)eѪn0th"R0fؒA>Fth imrw,r 8urJtempهcor M-l Dw{sCbG.Ĉ4btiHanȾxcarcelefR,p؍eisi雀`AcepOfHڂ Kumpana a, `cal(=HhAڑ92dPlЭ־{cropAharv)t:litt8m.ep@PBASl؏Ysl mГxY1suff bSɯd9dPren0ۨIX/ڥtunmu(:rqpuݿ(b8yamazxgdwoWZ"Nso,"sn, "neXiɾjkHn8!ض:elsTo,̭XyhaskouPQ ."ײ"WI?"inquImHu).herderhateaveeceivedsshouldarchoesternass.oubtlesshenicomeait,rkill0aXus,elling`؄Cmusto."

"Whoss?"sked,xasperated. "T3fourewhief?>"No,̈hxŇ!Engoii@througPairGG@Oh,exclaim"dy?ndes҃eaner,wit1bat0/φ/Xstayguardtown.owbidarew8Premuc@omorrow,itꆨi,@sefor 'm⑑ed!1sap cl@dehiphim.BaashHan"no;pwrrevaSoYwen@nXalkYsoun*xshsy-turvydiom@IpnheC_siXIws8Ƚ2I t@happȷ Jj ت|w tookPopZ1bl|MP-lpossi@fQ( wiIȩhelpUѿoodȵadepmef8sArklI]harampq 'Ѯ:XʺKsoldiQoliteidQa8(ta@bePbuil@etwq bɴolimb9ret:rotpiaryAapagefxg@cipµ,8#rec*B;8$pȈgsourؒdifficuЎliwritae8r`i¤ecihفPyself߬˷ssomn@moral1tm!.kz,ؗJّiINوO˔wih!r`$Hromroٙwblaz"suddeHKȡ٭#aPumb0peopȠe胉Ha0ca8 Rȕrrayadxsprix: 8esO>xd@)8~Pyџ agh-+8uncan("-worȥ8fXlili st ѦGXY`i(tiquptg YccompaniSmuhmecas0ldrum-bɬ4SH᷂!basj0octown>AftЬbkfas)nextnjKuaqiveO|kirtpmeHHarcasu,ҢУȃqcon0xjbd4tiK;ar9repiryHsh!9@e!itib!ir 𑭺Pho¾AxA5pag(esXVhor0in theookfob.

Hemiledndaid wasladoxartthathopIhouldemain sameind,ddingknewcunastromrate whichenterMone-l>Iflect xmyselfSthisbeopcompawithσφleave,fhgoehance,utX 8dłinquirwho lIafurossessionhrway. repli[ey_ovai)-plac0wellfor;left wondeerdve(tg>So؇n8cloyurrou8yguartwooldiersrysiPsmmunit necharyit.archhgStown@awme(anaa damag8 qgeT2excep alyءttoo4tghEviPtۂnelaap҄I؎ȥȎhaH*nehetAsiѭAcas 0s:fonfncihgu@ sis"unir)Xm󠢲2ma";BPdo𳀐RrnI Эhavbe@tز{sq Xa”Ҕd;_fi(Qmadn`ink;su(AmceeWg">hxeHba@,ҥ' e"army"ou na')n"si*hi fift0p!askHhimk2 odXitt sIiػex۝X3a-bo@Rjdefe*ܝehief.htreng@qA nLH@I@dara w9expecYi҈jy0bl%know esel8/qeer, îdoub|meYordIdHcQ(qрe;dY,(p)8s 8icir꺰9encwor manypgHntHbecaYKanek'\fraI! hhwisd(reap`>ga`u0fȪoQgsco1aɕAgret??>Wrch#Cr beautiful㓰#floorivuletsjඨnaau`ظy:difficpy*ej,IЦٕsl !lolqn-sx ЌxB訹 AlSsaЍpwgrazppa(Qun0Ȩr0er,b+gf1t`PQduMgؾ8ȕמժsup@%ף,aturn幂.rrhap)ti9-\,ݱG*A ʽhdcom`j䫑dPY>Atеګthefternooneameoillage,qreachhi1ead!marroundodeepleftshat,romXeirXeshppearancgtpthusIaw,veeenusedyAPcent thquakes.er0ewlden,ꄢwȀlso,(pengdookingarge ntitiesfooevidlyypreptiforurrrival.

Wnowthfisixil[wallcliff|surhol0erthougcousceXse@hisk,`J*܇a ljtikJpassIth8k-ikntryYt9tre wQckyutviewHs4asxPlx{teUKumpanapus8rema鄁8pla8ilanHnighh"Iag ,NI#dawn.ask8w,2@dodi!Iit. pliPx9not뒐;erhapsqZattack*Aba,!waitҝXusJtire.Ԉhbe epmquhs>Px(yg psunHhtyaܢaZampe@warddbn؈ggbmeatur,9ordexI0emeXnc(wslՕ@boПыnwJ'qbkfParm8胔t`ߧ>Havsow ),9s)AvlZJmi(I0dmoZoZЙanxh/ab!,oPeloPincommodDaaop@rzeycatOˆ̧alwaysph()mbC`lopTtngky[0Iliq>P"sud`ne8appPavȟerndhŷraؚxtsHamtri"upwa8RȹN1el8*sɻI8mi ʌ0r hmmedi0qro ڄxuiמzhqaanePs پBaspPonishJburv(ci驩.ƿbeh°ri:cӺ@hquakeKsnarrȴS8ydjygu:{&suAJ تacross!pm0cipiȲz@@PPuppX,wks;yanyZlittdebriScleft -wᾩdamarhAEӰtoDl.h0ǽ`nc``BficI)"dhur`iculspInaamgnoђunbe βz J n$wˢlsel m`?droyoyctiongig`rٽp'!Ir kedulaclysm؛Xy̷irPYrnbviounoProtXyal[piercn<|;biA1fusaremXin@pXro betwmV*Afric8vyrmy0 safeyp2(kp lus0jgoX_repilЅ*:orl">DPKumpana(e?wosxgaz𡡂0sshce.orIXkwhhH9achc# `o, whyideomehereithiseggarlyittleorce?ast;ssubhiddenbject?annotell,oughniewfhatappenedfterwardshaveywpiniofatH.

ALLANUNSWAY+2"`lor="black8b>"Ifouxtedool@`pass3se,um0a,"said,oingredo0ab8tw`undndifty, "nowh grso!(ړbeone."?G"No,ordansw"possiibytrengal;v0charg ccouPepswayirrnAenmg`ThRdomeanqd(?eturn(again?י@sa!.etgo lookrgapcliff,yner8Xhalleapmus.ty:qAba`r9JitsH,Krun, y`afr񟪃Ѓ`aP 0thquak2outM-l )swȓ empvGPb8myselfA@unئُmistn,Jڀo Aͧfuriodesateaneke>̖surd8qmpastolHnchicuggfatsmМledgߗiprotxunseBsn0ntmarchtoSnp>"BaaAȞX"h c0s@rpAon'luck-Zms',Ylkk9beha't0Hzp0A`sualpracticwisdom' {qHambushanyLsort,e)u0Rirvims.Ө@xªЭsne kep arli\lumamo arriered>W)WASApc[-cl ciU@gHnScott'oem1remembaIcripah0aghhillseȸrquiHeruddebrx+1sprpfrir(cern-brHubPtuBrockѝJssPabo@a[IecBcpehtZ`CrA8rgg">I,UEngoipvelo0rfulirvityԙZIpԉDaIars-m[bQkф pkmimaPq b(8ByadvqmڷgPpaignoht.sousZ⛊I caXS Xȏonsla|savxx.urogɨIurolJIm*Isuy1waiQʣOк˹ç ȪCmnx3Y.eyne`r?8Ru !eeliđ9exampl(AoffnXAhspoo NihPaIdexcfoi`pQpablǹ nk8¾ز8(Yarkkbe@nNexP*li؅qodnner5irru)Qday"l wi#n(paqfung@NHetermiYй0wmFo8-ɚpox {a@wI 9fie=lsoPe tep 0d@mi蹠!sOO>"puff(w`ٛQaHwowsI, "i@le8ogoattle,teastereidinghemutft."

Sower@bXju@nomeт0oactivmohXus.Well,o0aostoryhort,ranllayithntervalsoreposndXfreshment.ookabackasA膠ddenselyoodcount@wh؉hHcampnighteIawPthis rategicaltrewquitecessarٌaistancehllowAbamyyZhund,r,nlP fearHultipliirumbeHthous .yIldhruHdiaghRmadpuIp8s usrOrerhapsㄩ ltoybe l8ombush advdcaution,en s0ts3.ytfkrfromhichscaQzdifficГxagaiHnzeachDa-tow։ؐven8+turnbtwi녪9ourwxhne9iؓ随xCcilawїait) p.vixtpkn4mhowcansڅwatcytpo[altalatmlsoKtun hprfBbeHIconsump9(ir`oes.ǂ؍s!RЏiespeciyd(kfLHanXw蝊u:IobligqohoPphWhildev0Xmeaanxiyeixًur@F%ɤlizTf ;excepZˑpeople`hȃniQͧpserted;bod=beengW>"WZg?"⚨(?/>"I) X osp-eleptsiexBaas,"tuppHًro:mh, "KѲ-shQo\:iʰKK anrh˲xm2li!*workar.v1gpuH"ڴng1y@gs"Ч)markѿakfugsl1C uѷn`shud@(hOOsHupay.Ϥc!mu dd"C:x躩lؾ耡:ngoiwaits!'>ȍ9ung kĽІɍ ؎st afnoJbe-f鼓aPrtYriupl&wooJhalxm,0eөLadva i Hīpnes߅Ap( r`becaswampy8oil0,bșJ Yfإ`@>ncڷqmor aoany(gno@Zpaths9ypvei;xun>"WSdoҫA?asϼ>"spInsXSؓhen 9`s-o!bolȻq,^rknº+yo`"bi ohem."

AsasooiredPnqu`urrbout0ispnymatter,accepthexplanationhdustayownsleep,opingatumpouldotiveЂslipjecotime.ԅelltruthso8haІaf8acyalo2l䄘iHtlixe,{readyІluck,carmuchhappened.GGOwholerew,i alwaycasenneover-ary(Xmental"physichexer,ځ9suffefromfjunpleasant enceshaflicHansmyselfueturnˀvisijalak0OHdiwe;nk Qkmidnight,monowitsquar"sh1brl`h3bfle:1flood-wr.PsawJli`s`owygigicms8rcgetweke8up r8YsidzjKa (ndeaʝ,񐈜dm(HImembZleph90wes)xeș9t th-)mbg ugPaXs`doubtlesyXipaCwi(bts>Agrz񒉌x+sunup.eo()fd!uspԣoldiers9$m#P$brouQ+muj閴ho:k,bYwardh1XntyRЦ o>Omefinished,gaBrakoffalkslow*i4I8ɯjLdenyy(icPs 0pacorXveZobservYnu𔑡YdiJș&CwoPIif.ΣIPma8A0 ivaLoo8skfʟIg8/>"Oh," ȭA"9͜sȴ2*u۠)afx(ɾaha"Prep译 8craz(ӫnuxs0on>Чdiscu,at¹Iѳ؝okȤ{view>"sp-8TtHou<,aasssaiQespeci`)iz2ʗmZj`bȭ¿һeyeYI$oyssayItjll?ddࢀnlys!ri0s.""HabIabХHY"I{zYy?":,l''"Nos.ȵsr0bh;erhapЀdeм0`shipq蠑Aбxun͈(A[rsgйoo>" !ajectvoic"rewY񜝆[AbgouWJmʿeroe qXea鶇ɝɚ؛remeTIJe8JZsamJ x0bSP)?WE` a0 reo`iflthristi0̲JȚaemselveXh? njSd骸brXoHAta˭abɹbus@shb  r8$eirsaga oeav\//"2%Zknqg_tye۩dworb:OuX`dxRhRnpHmh脷noϿǾI낡ɧXm!abLalmoI(myfLitXȥxerryishedoo."

"TheneughtQhanggether,orhatouidɀ1.teastgaveyifleiaavage,nowivelikely0shouldeeetgain,oshalleefencelessxPhenean(heseabhaЁmakehmockf턈whitahsromisSserxm">HeHan9cameepaffectawimrHqbaShisAdqfllittfac:wipwayRtears9me.ooF`hi8trudgonn󀰊n saparok0voice:77"Baas,wpquriɓgi0(rGlY ca, Xcustomste@`iHto kedcannot)helpeBu"direnhithbImHyellow8Xbpnqsr oȑXIveoohWIm!?!n'tYachˋwAIbTJeQu!Ymal yhthx8oronesHjpkZanzibarКJmqJupXs@ɣЅ'Paschool;@i8@𝈠+hiKanehZPӏspeAnYi:gnelsehwsgoodirit,"i "Ѩ* oߪ">NhreXreɞexplanation.׫ڃXaboflҧ/hord9@aBt(+afCЮobCrec0*Yalk0twycself3"hapxBwardAt(idur&r,uȳx,PusÐpIheav䅳ammuniyhIdroppbeІȲPpJgu0triong-8g1soldibexcepఠjPee)Ш badampb)rk񱹛Qenab`Yp9pI;2fpnger7>It꼠arguu`jif`ircumsta# fкJco𡠮doub@HbQruɮyN`Ǿùh3peo9loPp1brp`superivB@n`yeehdy7Ȓ؏m ȍa<܅Icid1greatesumili®f1p.θonҲqPtj弱(8eas cis ¹Фr0H[hnj(i!life>Fmod9+` om fump rch:ithuist,gm*tQaihLaldHxen.ƉIQaselephantdme`tPڐbQne(@rPA@mpth. X[`Uy빩Dat3iihIndeR׌rXvТ'@to masyyloѹbh:0i2Lsavag؍:ѻcעXpH4gnizkdiff sm .fHurپաaɾ0explhIalsxmжɊgBanimalqTq"Cbsurd>AtPngto nɻeme8dÚònak nx uAl8[AshSgaIalndЏƕfa2gladйeyidmemrkXhifQ19Sڀ齱єpr alѿd8ٿ!0򻟻>P(=am kAeyheand.

"Iee atouookepressed," said, "earhavd0time."GG"Very!Inswered. "runromnemiesasteRnvPIXbefore,ilostyrms,hichxsoldishouldoto`y نavoarry,P.orndeediwantIP(people th` uPelGBdon'torbthrewmwa Quamain.PsamhenRAbXauntx ra@rioutrifh*stickiȎX_Tpoicbeguz琐b esellȌYdevilathislay-acting0an?hasragg!Jtwodfifty舘ohghAous0sf,l,Prsimpossible?gamsurYۍin,)mnlHdІnt{ityxng.if*ask IxliڕsekitanekainksK rema)msnnpc:(capt ي8r,il!,_kiB?suw0wZgeБedknowisqsroPmyT,lackarPlsAlsoRDa cbecoiXlpӘ JwisdؒȪaEngoieo ):m_XStMxerstѢbqgh@ace(nh9Pxcept"IWPBecausgҁͥBaʝ񦲥]afI.nlԥ'"foll賨hڰnmaZPe̵4HoL(Jrh0succ -؞xi.ĭҸښAxngrilonho(1sdusinȹ_[khop*!alaiFf0+trYupЗHhit`8xڴH beиhelpp{speagBesideJasobjecllkʵ!empѻtYi0hr s r29Ǽ'"cap"!a8woic i*ڶ(XtroygrУ$erraito(untunNsaz'";dpriHsX>Amȳ`Hud𹇹"LЊ[kptoware؂o>idBperce,body࿶ѭ$m,mergQ*s`ow nipan.ԥZuӹȿX\rkXsmsoӠh`imt10matw?>"Wׯмha3t,Iup8ԲH0a0AH)rifle?f,q2dș3ɟQn#PWPhaz9qWh IPottoi 'ea(Anlawfulڲ֮pnAo1mb运Da3-rHؽsurrX rjI!wx.onfxensu@KuQ`!fhrH8mar`l$ٛxuk)Ȏf1rselvesushzcZp>rlhstooؤrPxcepzevo0qaewr ®0rh?bynYk!ba\secoPi#ڄcauىضo{de-l@aixXgu1afes,ho.ebsex0Clh,Kretreatasmpossible,behindt8thenemycnront.

TXAbaarchedn.crutinizingyiraces yam؃struckeresomettterthse@Ofourxwtiredhichjno:angpseePafendurE(rorf+arthquakestorm,+haduullwaymownouryrougBorest.u@aspecuggЊmnaHess;EawrinWes.hy?ondd;incHlthyust@veeft`xYr,erhapzoccupatiHDa-Pstihoutnumb`orbyee @ftoe>H+dventu0I,YoHanId`?ϒ`jiovercxan.sacrileXHviolȔbiddl,p whosoilHrbInmspa oxexcep-lea:XgxanekRffu@fr(napal gea)(ldJtell,xcertainlyl`righp@aiyiffnt0bofowPhweIhunbArkl虲triPcoffass>SJ)noorҧ(I@SaHmџQuhYppo,9distm)hselv Xsidp8hed.ow Ivwgo‰app(QI08x`mA4 Џ@rusqm),merg8 kwalk˫QiftZͧBsuitafdÄaBno(wbرZloeavpرYb)r__>"M),"Abigoic"Lyou1xcat⹠lhthܴ!Iwaٺh,@غ(posȷU!`,acumazahhlQreaыޕHsok0" (HhmPawh0Р'taihaolr0ɹ^!Arel[hfew(rHd@refrry.)"x,w9Xm"Iwiso mbI=pophIli(ubj00e@'댩erx)e9~s(#mu9er{+Xpanjney.Ԏ%#BWefшYskulkyo7ylXltritag2steQSQ @fe$Qaup0\mayWSbf¾ፈmizrlb"h1ȝp;,/unnAjaKua." orwarsaid㾨rp᩸etly:"CeaлZBboȿAtEizttoxsirprfdviѶ en]ayePrd0scjfi3tamPou`ccH,isI"us?ٮqs٤qpsPppty?ģ;۾psŰ?Ǣ9uHbeguhBdep`ekeepѷPdroyoo" nciprophec9h@ʷ1byŰ`Vrockstur"mtJfpeoؒitbZ)X"o@okm\l ib8t|r yׄtYeXɆyseizmadAٿul0dyJˈ_x:y[weltne?״}w a filsЬдɒnedasw`hȸ ,bsunsettilleooate."

Nowouldephat(ebandaoldiersereuchisturbed.heyhispdnynor,Homefiraptainsganiconsuloge.ȄhavendIo now,Poughubxhs,omȄPbrloyalavagesentsurr1؂mIydhohsDgeneri hattemp)ossesBmselvesDaz-lithsHteriricboonwtyHliev;ecspiritu8protectioni,ow荐remXuci,oranekel!feayworst,riAut:oo"M camBppoiShielS arezari0yolow-bornumpanAsSPlX?h@*ounae dopYoadwayrRimaking twndnЗaieast3alstym0d?fu,askhiterWatr-by-Nigh1Tyel0servanP@Idp8rP.embҟbut lunhar2lasXflep0pf# Ho!tf"ڣ0}Arkl@نJp"D`off0ak:.9XwȔP†p)fтxes0quer.ÂOO,ay!ϟ`o0Ow3"0oos rfrfaw*-CP8 2facSim;Ef`okpؕhخcgߞ`(htraұ8ori)wYaȔ8$xqu1unceH dropp xbeaxnbv;l8ac2Qyᨱnў."Lni*betwIus!"uw 7>Pf!!cim,!avoɤ+hru8P:iXgri)haf3sn a ig, blad ewsX,-rxe`myPb|LonB[gIyhitȿDissuStill@a`s0Ixxsse 9 ddasYe0yl@halfunSe𢃷ulhpirppicRHuptشPȧphiliarʅ(nkػkDa뱳{ Xr ȼ[d!ign="c8er">THERIDALND yCURSE?=+2"="ckb>Tѫialinichdur-s@ȪHchlPxy1eam0esulɾwaТIdluemselvesﱐre-PЂareed1odfirPvisitȰ޷ry wayAuqYraquanȃk\dista򆉚utt]vi/tغЉJbeyonܧc`\^lsl)turazz0xgٷfraysinsunww>O*s~lexact(H`njkemiϼ]@uddy "ahpno/a1[!sp squarIpaddte-rob,rVIayxup8escr)aang0nnQ)UawpooضXoحv,,enno:9cHmod`o son xiCxtatomanhomnewusteheasalledEngoi,rhadow,(tndautifuloungseauzyobeslitterinsunlighs0oughiy(ewitholdJgems,icherhap.؅oa肸ead-dressCwingnot keo8ofvik'slm,rj,alfdracelowneilpangstars.

Onmboat,ontly(oneouЅXrJpaddles'ip(HitsrowuchshX,iessprorwar{8Xthst.ԏregal-looI4r9HeePlҍ0wpgreuf:"ENGOI! ;"LjClodR1burnxtoobovesbpoogazXtrate1mKanekH pd蘈himCte-Plarge-eyXDaba0smenAriorsxyondnpoaluHbvoi yPncUIy ϓ>"I,Txsu@؟LaI(et9ervanЁ ;'׈Aorf0away" (thi0Iorkle;yak). "u*e@mxOuma,aByãcit Zthensˍ ?>"T,`Pnpi8f"ravcurshaday8ТolM90slayygi2die֦Hwif`dog."Ȫ٢Aoi-I!recحiseraiseupaذlised x judgrac)ccJorhw,"ai8"qҶYwine )gainгloudirembcger: "Mgb.[ɅclԜIercDFtdepar .EGONEOHEpASTSORUDGMENTND0COMESHHePif8Yw hoffK8cpIv)od0rsins.G>qycҨtogeIuppdJdttack`8 s,Ssu`hicPemseizm.9awpaXX i;<(hொart piؾ{el| s`dba ror-ickmobQyBhthunj9s9di @ɴ ;i{mn;k2lamoks esbbeautifuPcH3fixʨrкAhki aysoftly:GG"a amxfoImȋpeqtydi۸B@m .ټikon"Rirtigc[me "sbIrolpen.ǷpxȘleaH PnpgЀ@sɸHa"(3мٸsh2I.̂B`y n o@HxP shhȝenduA9followKsky.hoտ!">ҨbgroH* 81:hdoubt`Qm`dZߺadiɵsh㹨 һпknebconquHPݷpW_>"Fwell,Ұ0knbe8maȪxderhapĻؚacc`rudgmenhڼlPqøa0hslxY)wrق~p)auȹsdo𺃫dinq|qbo @i:˾Hђgainceore,ndhinkfetimessehallyou,ntilerchanelsewhere"Aheointedpwards" meetgain{Xoopderst)thIannotpeak."

Heky 8pressit,xenerylowl8tepponxowaboa*assingownPsengthetwetwoinwomXwholiktatues,@px(poop.sZsopen聙arm receivimn݋yibefll.orpwَheyqpeople.ߋSidȀAɋmselvBhrone-eat.ԋiesȀusʋutwater:ddl(urщҍtojreePtslayyoKmunnk/>I ;holahgrewar8lsrang raveldepar"gloom.Ϛ)(didsermf(ˍښughҖDŽabosoma.ӕhlouxbovX+lapray& vaniP;cr1iffdreflec`affa** flxthoitphap+xry8}~` i碿>"T'QښXRBa5tt8k-lady2hcar({off,"mdans5ly, "ɏeemoad,hwluca0IpoIplpObackMxmecbspirrklBlewMmYsoon esirYbhI,밐 gbodfelt;much.͏risRbRo()idirworkJpWhite-Mous@Kanek["umpana" cruIڶ iXNo`ɺynjoТumbiaQliXa nhPwithg`npA`@lddѥBdis@bedrsolemPmyHritha!mofulildfdprgJwyamoT.±pcwȑcoP({oun@ chfisFiertirielephantboЅ2ȿbYor92иz2cefr`x!2x㿰p`enifdnRleepI8ulȏYgoݹas)iaSrobab0f9 Gto ngthoo2noispcig(0 WWBeqr$skyyCm0(iasj8ppr@fy saycuet!arc@ tiHɽa᝙w(pteYIrp@ۏh0np8etweepIR82 sox2lмѺȕHhorr@cm5Iuȿ )nbHa@orӝ va{IZkHP5>"Sᡐ,R!saipoinddyGGAAPпh"ԥpJmbouxDidn'tou(thǍ#:ٮÏDa4izarbrouJ?"??qUpInlrememb0i0HSHs9!D"RIaPdgt"!ǹto:%!ѵqu.ԨrGHqs2,d(ima<+yה׹`W!nd!ԟ2aHisdarsŽ@,f 8Poie"maddenblϭtrac0 themy @ircent.fisereatef tools,hat,ond8da耰eservedoranekeoDHy, hIupposhadeenak0onheusJpawongkm?

Untilnm8lyislikDabanda,w:tm esivsouchtoetu At1Хٯ0x8ߕըiea䝈ݕӥnI0lagaiI`0qwvengea⌏) i9bull2y rchxemNacrosK%) apped.Xc٬ m k`,Һ֫epar1bɱsRax:ifi@حzmO>AshеxIڲtx­ soS`naɽ g7wfulDQconȚHQmorOopspansu8@tc󦑳`nyohYe й$armlrunʾq@@ۛr+»rk1hrierPbbçm JbravYmacBmHhhuLfomhrP a@hahbita('leshOO>"T)*maPBaas,"r,etbeXdzmmAfri1veH"hoQinsȌC piH. "Don'uhz sHloIo."Hex`tjc(`des¿h0fsibl虳ideo8sighpopcup4cbXsaveztoday8?(urvivШregxs!Z@*laaiiBaunH"e@)#?9Jm zyǶ>OerhappK *isuIXtismkept`pV$aYxsorHiHloSmȬr`mbeur8ӬٚotznеpeopСtL!M(xxbegّkci ""ڹBst8ӽ،hoc, ʰAhank@:h9tcg'uRhowlln۾reho8(8y}q>SocgqingadnthضPȶqui SHchasuitenharmed.ansndadeur@yoZownouseher0eouxaampitfoodrepared,h`sumeXhomen o(dpons,all0is(ileademainHfhfullytairost.Ԃfirsing@saw@halXifle;ammunition,hlaibeds.

"Allgter!"xc0*,intIo҉:nexք. "Wveet(nytrangeeopijneyBaabutver ikease.ut-Ѝno(iz(tcЀizardЂynf)mjXmas devil, tAbxanknCgmindg(."gg{o c, XsaaPoolbega)ymealsncIooollapsed;ordhscribhm9atbrough@bophysicfatiguetponishy.mt alminclIgre2hdXwcI뀉BJntcheesofsusceptib`aaturZО0xwonder@Msoldi s@ldSbeIttack`!fo a@helepha#temperHiu0rm2earthquak`orgsurvivoЕdsfellows crazXexiAhddˀffect,inX*suitz">N(8Jh8ArkGQccumucbeautipss`onqtPceȘPmyYyے;syPȏ|ImRIo!0 0viHa c+,f!mb1KV9syowѱexih`n@1ii*raroch0Iy򟚥qbX1øPke>St( 8ulx8eɷppenPreinWegeWlfٌ=ctm ?b9bnun(he IҞ!`H!jYvaqawP3XoB aEZ`iIadis xcru;le؝þarPIpuzzXY77>SoIrqfd piqXkоPጱ(`eekf]krecarength>Dp@zlittcلporgtowH9u`. 8xopXcul(Sg:s;Cac9+re-alta˶YsrebuilʮسobserqɠHٟatchȶXiPP8Іoudf+spJ1SKAAcamPblsmilBpologizXyȦydIH, "FXn,"ad"Imdoc,rabPeouackly."߲IlEdidzmMn `n*suxxnessnsk(hi news>"xsD,̹XnsI"FUѵXYEngoiʻhusb(;ShieSaqyimoayAȈ9yHHvfͻgaHaboHtwPᡃm{kelephhs aRhum:Qmsubmis,`o`I zਈful)o0xhssneeople."

"Soouaveothatwant,"aid."Yes,ord,orowehallecomeretribe,xnation,ndeeȅ"cewereundredfear0go,yausehe0Abanda၀brfightingen Airnmanyhilwhhub@ew * .everainy Hubut,irectedysdom0doiЊȈ`dxWhichsrbjȃoughoauppospKumpana?׎׌ik Iexplsuvnbeblo erstXmongstrpwhyabo͔H-itYKanekuldtKsdromrabx HteShieIShadow,Dft8hi8adnessxd doyȔ؏1ntryfvIunprtB0didback,ee2tookwayefthipJ anlawOaώ˙1on@if 0ɍ9returni"dri ə,ywǝ:l @jheBattȚڥish8s0XdkZotaЂ.Ō Ik_oXEngoi!serv1zollowC"Yn,ClQfa0УQy,unnibei8aAjal5yɫz(!tpas`tell1ʯI̞تsOO>NcoJxra (be@I+[lyrgui1ssgracefulpiso(c(er@sar`m:sawܱAarrangAccHlyWPOf9rɷڮgifhreplim,`otP9voiAhumZ0ignotolϽ>TYamaz@/bhҵfee8ch1suPask7>"A u8a Phusi mGtegiv:oomآ@mi,s0<09peopleGw mIre"ic``ynlPslࡤlhra'y@'. "THsowonci8i0rHprC4neca2upon P9Haff(sto2઱8g ɂ8aws-ws.o8ԽrriahwiHsp:aPë#RxhQ.ɥsQCw8ra *rihr, "mm$amA)Ӓ:Afric`8adiru2ٌүdСxrpoxoo+Krophex_Y[1[moc if0Ȧ"wx.sQԤtX!gh{(idecqocuڮ؍l2"'g>0nʱhloy9IYeغt(r踺XnЖ88oubtjw9ɴPfPw be|do__IɽjIxclaim" In'1pȢby٨T77'!ʽQquxthȚɅsudsxBal@ٽ' W;eغIuP񷐼I1so.tኪ_sha1IescorpɎ\mfnrmoqboaxxfGG>N@unZI embIhĽed himhatadecomefaneke.

"Baas,"aidans, "Ilwayshoughtoulevernqr ,ut isumpana Xmuchlxtha,r nmecauseseethend 8$makesso,otwenta8nas pabohitfterwards.ehallxveoo1tetishsines`oni`if2on'alk,{bearrieRre,uiteicelc(sbymЇ؊Xsingqprotec.Pdˉ, .""Howȋknow?"snapped,挐ygib0酸tatme. "PerhapQedyӒЂ)usbwi0z0visH>dnk󎸆 Hyrittholeao's8nd8facp?says@oon f wȃxntlpℨ‘`KeopleoooknewՖigottWQ,sou8ICA.œp$3[,nldeawhi heI'Оraڜ힂twhoeep'Swee-B'j'"pnonlcworl`Pretty'/W"2Quglnerrepl a8>AP1XniӆqȎsmetruthanitch-ctoamadoist,Pnduc`ٞ8escoratro񠌫0rCtahm;a)ient( Hsxrovo9+94shil9l4HѰlif WoI"aاIuHati([,ap)tic=passagmQ`ڛnt᪐ipixpruҴxchdhunrsal.__>TQm) nXYɹ0ytutown_gup arketcpcDimpgumbcnvhҹYfarmsXyitXor@T*op )`ce;Ӗ log0𕔢ȿsFiosh 6@xs;chohiddbeaolemnP𿢗val |saiblaz(gnbЋauntaixх`gȟߏre(HwXexQuisx8abIurn@Ͼ>IʊieP٠Rsd膠close`guhieXisDte-robCci3Sowoffm.judrHrH.γi4)"pBaudienlow1w@P&g|umpanaZramaparBrxcu nϵo>WI 1Ԇ9gXsJh0kԜcAt Xgta˻c8no@s0ٹdiԨ erignia8aI<h(isdiclawful(ie`ٵ龚rtӐ9p(ampo轈ex`perhapcauȳ*qfrhd deӓpeak,sakV t:"W1?"reʼniᤨtт箯h8lty!"+gIrket-eneathchoedheordsnoarfounds.

Thenumpanari(alouXorastrologersponirw,king:ׂ"Whatewardsppoint1ـtraitoraneke,ccursXqEngoi,8sinPga8trShadowneople?"ivintarq ma!xpretenceconsultɋmnpokigePr+secanguageɃdot t.onpright,alluto>"He)voiCven!̄himhou0h|firfee.W>Itempla*Xleapflamewhich#psts uhurmor1odWQRllP+smeanremark+HahJitseemwxח>"Oh,aas,"Irepl, "why 8ouАupid?on'te[ Iourxowl-ma0n(ferP? woѝhuPolhxwlways䜈oHy9ht`layH06ݚOIIsometi(Ahusbli8Zؐ0GrP9s!"exclatxquitXt.n,eqcou虐Hoڦ1,֕wQr) show8beiQbirth"ArklePlifqia(nxbulg1eyHbegюssippeaoJȉ«+trySyhA ehalf,x񐊗H@YqpH 8rp!ҙٔntyroomtwoalX.ddЉrnatxSnQzianciw"NZminHdem djmish!9punishm>;iYhelsd$topD!PanʷivPPevgalackPmJbIbgnicomhwal񵠳˪qmepkPoug$Bfob9ououse0񔙗mԘuɱǽ_ZFwell,acumazah`mxhRvilYI؞APpHЩE(rP Xef6ZŸYt“aP芐eli zliT">Nhmydep!8Inew 1e@uelIbespok01isejfdoub(Xhf4, Ͻ7Ce`lyriihiPjIidǿG>IYswkAaPT|sPupXsong HavaH pr n3‡med8\et-piAulqa8Sook*,SŻXp|@lg#Խ0Ibe㛪lݞhʨ)ipnyɃ2sii,tНjoy>AJrȍhX??"Ba"Y, "Iml:bt俷Why?aasp t0Hss//0h1.irberleftittHXJerbe8llwArunnYXwydxȻ᥃s;selcتf!Qwoh,KeҺ:i:.ԿhipDȧ򜩉/>"LupHomorrst_@Ye,xB?>Hdon'thcZesЇ˜Laccurپxntry. 8@yb tᝂXHa1`e𽑣qwҶ|riWgWʱwanu?gnuYam_闰im,aas.eadinnedgainstnotherӀowhosePandanway,rPriests,Znevforget,roughtimackapeibeill聈(sa.ԁ)whyhite-Mouseaentoempfromome,llingzUmarryznewwssuchfraidshouldₛArabschefirenaltar.hheyt`illutu`icel!(sanekYsHar`."

"PerhapW@\won'rME*,".76`ign="c@er">FAREWELL+2"olor="blb>NithexecutiXofeisavHashIvescribedtomyis!crlacHHMon`eopl8dwelcʟxend. ,Xw!Za:Xrw[m>A1dayllowhorshepwarlat8hHan떰ptQ dXtyupoadsrbxerIoinwuprovid nextornh,uperixndcookIfoo8uXsee:orootworwЫth.ɑXtimeth`linkIgtimё$(-Q0ЫreturnIhi˲(8L-countrXo(riHYa!aj0nȌWCoast?Տsdn Jdopo؈difficultzdange>WhenlX؜nZItxDunamwLsleepp@stp(uHns`B)єr9hopmeanPspiĻѸAtXbac @auri=>Ab midvoaX\ȧPjamJIebdrapXaamantq(ͨ¦app!lĉB/>"W)[ckensqbeg@rhurwYsӃ !ouyhHO>TdrewZveilP)t rI@WBM e!SurelyfmiXlt@g)ionhntwichrQ:a8ng. `AXdelicsೀγpaI,rkyehl haisweet,ɫhi iysuggs`ycquqan se)9mur(b8a bYh,SPe4trukhalxfraPkoufзAlIwlawkahX4bѩضm>"YLorHacumazahn;)oY9qfawamoArabs.""Byoud!y0ѪYa|@yaKaneke'O0N!JyσIscҲi{ӵ@sɴq%,ٽ`r8Psm`0HxyG;us!owy)?>"0cmreveal ndoxȭ[8mx0(nӌwQyon3'dw "AgaIg0h߇スhost,hite-MousTwomdotalus," ai`siooaeittleoofsh`edm[lwnpo0bed.__Ttruthm1tpmoIn(estx0iwr؏HH'xltPgЈknow(,9usÖ1,̍Macumazahn?Ԃofei"fleshgrosx;-Xmpsؙ`wi!eјseen. ,yiHrhgs(H.ixpȚșliPn?>"W 1speak cr4pb,(ciy[lהЃGO">C;fIPac acAquickmi8strape1rrHanerveQsIcert`0musich`3aioliXAtstefinabI(0lwaysnnec<+8Ў{uvibrat_>"Yh ioyҫ{,moȤpeopᐊ)z* oi0-aandweall-bouAhauٍؐhwicPx)accompanyqIEwhyetǩǕmeaqskanxiPlyw>"NVnefexcepIkb@BsbXwhomiy h1watchfr;ir)dP#orntxĶj1ʢkx{¶fthprad.ɟoإ rlh `Padmi paba.Ph gaubj;ILalembarrassZga0dyne@pr(rcadp, "Y8ϿYeȬgoPwevbӠkǢiX0);*y1ЁZfulfXmselHпHxlatMxo,siLɺ‹Ku axPouݸêvßexSm, F(xt`ǶzyoohBecaZВR.gon;pQ ili(uri;𲸺q!twoةnmidLaM(sbanexknewa"P8todayan'ifȥ storyŹ۹bЄȬdAp aiٳ1YfQbookӶ񴒤nt,BshfollafXw">NIxfl³Y8epochsЖ8psi Hopin"impo8idifficul:0yaP(А[WAٻE*holh" Xo @uppsoBQ:GG"A@HYOUz߭ʦfguesshrF PѮm(ubQbeHsavagbli@tZalfa(pø觨dx(!racegȳansٱharpl("'sawruilQnʞjH@n 0"jalt Єwrx{QOcrueltI cl½BruXaEdoaʺaAgHʷYservantqfaoH masters.henheearnedhatadhanctoanekenrthose@om d hray,Bwept,!ughknewthethingsustomutxiPdecreefPath.es,pn1Larenou0worl`(fixur4tsnXaven@hich造 e.hforootudges@rdlLord,reasuHwithDabaulhNowɊvqneoay nX@PPs:ȁYfpXyjneȇknȊ:llcplistfely*limanyhGo@tuneeemsdʏ!a succeY.Ӆ@arewellacumazahnIinkinwXalĎhb asTBڐ{…xirxult9BwisPn,sptimehm9shownli`Shiddfr8ey."

0SbentPwhtookynkissiZXpftcurtai&door-wМ9glidɀin{arhshhvٚgl`deȞJIXuli@M-l*HS d8!FmbHqo؅xrocaПqstif!voi@Hany3`le quitgoȢ:"I짠",aaif, Iutt?ɐZverґXgđ܏o`beabbrI`PW-n'(r,"saiP"stopalxgbbAѯRikWh-M1''Oh"ksittAupItPapH0!X Hm.Œ%alcO)tvdideѲyo2XArab@mabelie2Tw(aeal8fOwl-@D ȇhiAYIṘappIw5beca(k䉫Šyb)shR|eAfJlȟhr unۄ( мʒ,*JsahKl{rRٷ)ꮚsdull͚+נ6Brl;mp^IoserscPgrasH(piq)ttXroll.77Apat#ob۱yexpec8QArkle.rthusdiv="1xߴEAR <0idth="2em"> "YetureʍneYknew*hadpok0xsexؐAyo؊cJrascal,anek0dooburn@aliv(shory tHPbyndPobsc,yp`icPflu PurrSyؒiumisgiftsawtc((yBs؍prieihirngoi aertA.husٌpthJchooaЛSoXo؜y񎇎w9srxarospreepbenough.uwaؐostQurm0,Ino9iHsitt llowu0atak.meathmyselfYhqeounci3hrAhIknow ablish jpᧁkinirulIffeȐ঱po 0?e`pH+P8nt:mAfSolook#us@st(n90whola egadSI0t,t8onhsiddaxWWSMX*,en@appPawisdp5x;(l(beop0heyoulܵٝ؀x4buildAHwri9@tnangu08ثұdecipJcan)b"X{mp0ʡ0cѻremugbmin1op#9psXi, Iank"hrdDrrrxpeh bras Korkdrsrun.ol,!f esofaHp!beAHaalp`bo a:M؟oL8.by,retОjs @mIxpl?arIuHᒗpHde.̿pvanIxm!až0doPAXcasto^//,ww_J.ԋRKLE

ney,fhichhereasuch,ltimatelyameo)eandxokhipackSouthfrica,Iavet (atxhadeenorongunting-trinortugueserritory.

"Baas,"aidansIxoneayAnetalkPverrklehisrepassion, "wa'twhearts'you?"Ixplained bes could,eeplied:*rememb2KanekpjubepRy`him fire,R`9(llow+.fЈRmCXhavQart',aml0aven'toneunless,z!sh:ad,镰la(Ioubt)Id`.Δownfany`sw"dowRȒtosheightu0"lign="cen">THENDINDXTAGX 17IDXTINDX00Ā01Ɇ0203Dߣ04_ɿ05`r׀06RD07 08 i09 hŀ0A r 0B {m0Chb0DKj0E5€0FH|ۀ10D811|[12WX130΀14D~15!BS16#o17%ĀIDXT %2?LYfsۅCOVERTITLE PAGETABLE of CONTENTSPREFACE BY ALLAN QUATERMAINCHAPTER 1KANEKE'S TALECHAPTER 2ALLAN'S BUSINESS INSTINCTSCHAPTER 3THE TRIAL OF KANEKECHAPTER 4WHITE-MOUSECHAPTER 5THE RESCUECHAPTER 6KANEKE'S FRIENDSCHAPTER 7THE JOURNEYCHAPTER 8THE ELEPHANT DANCECHAPTER 9EXPLANATIONSCHAPTER 10THE WANDERERCHAPTER 11ARKLE'S STORYCHAPTER 12KANEKE SWEARS AN OATHCHAPTER 13BEFORE THE ALTARCHAPTER 14SHADOWCHAPTER 15LAKE MONE AND THE FORESTCHAPTER 16KANEKE'S MESSAGECHAPTER 17THE GREAT STORMCHAPTER 18ALLAN RUNS AWAYCHAPTER 19THE BRIDAL AND THE CURSECHAPTER 20FAREWELLJFIFHHC   %# , #&')*)-0-(0%()(C   ((((((((((((((((((((((((((((((((((((((((((((((((((( :" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?]_j_<=yxj{PL;n<~~(<'qѹj q13WiPUZ7cU0%D ƪ¯6ƞGѿƺŹufۑQSMq&3qӭeq8šq`:o>Q&<)p@7\.@e٠6`3j>SccMKLxoᗁvSNa=rT vc*Q5;v8g凅йCsՁr6;,n%wдz[⏬.E>*i\s~xđsNR9a7mTgG zQȻ4?fE@O o)"=ңps5;"sv Z3'4ݤH FƘp~HD."޹$QÑv9Q i@Uǁb<%{k{' !lՋH"0Kc}fp]`|2it`=j|5q~Y.")9+FyuLzÑv9[/7Nxl7Y[g>ӕ5۷[e s uNFҜK;"p |-5d~GqvPxbUƽW&+ UQ&yb:jwEWᇁeg1xSK ? ЍM9TF4*HϭH4j|>Sr.wP?ә}E/ɰto),w/ң[+i$r8ڏ|7%…"tR=Nto[#dg5Cd0AA{Ñv9Yv/7Q6q쭚H 'V/%N{b.Ee]757ջOxK}kUP4mv5;v9Sy @!Ơx-w isCu݀X38G'QÑv9߅ rL_"\7qg$RIA͒9"r t}fp]m~xXxON8o-~2a]$Wek&OJjܺmyɿ¯.ƞGѿƜ>xWN-Cv\HTJÀ}:Ћ@(NȻ|LxSLq7Է R)b𶜫aƺy6o`:fCv5;"r+;|)7j3fh\!k[҅Wlȣ5;v9uiIm5_W[^#柰ʷ?uZ=PpW.}fp]N_^̏Úr ?UׁwVG zU{Ȟ(|t5;v8뿆>_ }jſ7i<]+,j[)h=hNȻ2~.c qH~x 2sM5ѿƺ;HI@*9/XNB&̷ÏxKNa ֬ºr_FQqRG,T`Y9coVxcN; ֚g5-fwR6Zwٷ&۞ Y9c>x>ӝ JaI]^ʁ]U4ЗS^oBY\Ʒ?ЍM9TFᇂ~<-2IFajG+ܣڏ>E#e6Ηj{BSOt̀λ29ڭFɢ`xb3>Sr.~ T|ݎ53|,D/]6$a͌R4LV@H>}fqr. a1o]757{oϮUeX68=NhxƠ}587~ 85J$Qʈ_nLznć*-SuQ)Y]daRVM],`s\W῅?wCBj"hȐ&'fo$q+N Yu'# ax_Β5PJqȱ$śGD %Jo5fSFT,DKw=+_^2&U4lLI`NlW16ez8Lbx5h\+χ_ ,acUbS=TY5R1G0ePD'; Hcm\qw Y$#X=U⯅-˜{G0e⇂RwR*H2k2\zOdVG1{x2%b}44r)V opn <ŃKߊ  =#?}uąW-ȞCa5A;X(džT'?z??̾Я-o g4څDǭrÑE~l=WIQ6%G0e4yU+Z&kayJ]=T<'SWig=?}Qy2AS4RLKҸ~/x\ۼq_T2Y8̙6G~'w] =h/'U@5S|OJ4_M_Xlpt;a=pUF"}$q+OrjS#O~V_qSU ?O?/)b^6++?/z/VgKޏO?/>212,D.N}+⿆XޭIAE1 ?a;ƛ+ $%3\<*XX>B<ۜsoOuQBBչTDd\-ŏ ɆAޙ Cn?a;dbs zQu}W='CVM=υ(z??̾{\Zu=܊f,H;◅ddDpzV﵉g=?}Ϊ#;VP/ W\|#?*~.xJ)SW֛/ wHV ǃ ??̾hMҏʬi;q>9Mp2|Yȳ5r6P?²4 u*rޗ~'zpWRl(ޑ+[_k i>/TDœW=QG0ewHB6Ub=DžmTB{S/ſ ?O?;|n^3T?iH1k⿅񫘏Cޑ+xd96?zO/ĥ~G0U2=E'>1uq\<2!9z4OKtn`en-,+jgS\ӃKq it% / qT?o DWh )o#GEp+DVrO"=H1-PԿ{\KoSѹΒoϥ,G֛E }@fΒa-zѸΒsy:]ߝ6 8ѹ֒OFah9qw7ާ@sysѹ${Q@s>oVM󤢀}ާsy:J(g]ѹߝ%3.8ѹsQ@s>lrǦ:ѹ~Pϸ-Y}i(9qwާ󤢀}ޤ)v=XM} 71,ߝ%3.{zΒsg;scl}zRQ@s>n֍͎Q@s>`s3@f֒q?Q@s>㷷,ǂOMscoΛERs2q~ ·>< ['OC]€{sFza4쵿l(D$2k:U6žW<h${f'Hom" 2zF?%ձsf@-< WF Nz/zz_ fc ?D U|]Of& <ӹ95'l5>k GQGgN;W|y忴my=~kCԚ×R;GJZOɥ(Š~ۉsg+@!w=@QI-]уE5خrqk)ぞ􃑑?QҏzPx{tc?ZMpZ%P3E"R}iHc= =ŠFe\$d\'E#C(8&(/֌NsҘpPx䃀{w(u84WZlw]D;E"T銛QE0 (`!?ِ\خώFrF4;C\xygסeFbFF*W{3USpSgIr@ 0WҾ+HԷ䀨$n~xxjS mryOǪ/rf0U>) <5YM](Gv {י#EMA5z Osֱ Zh$VeB<>7]?1^u )zOÅ.zMў_'LSM>5Š( ((ߧj(=>LGcsg<޹>]#Jm(Ed}y xrOӣPҸe:h#ь)Fٗ'o# IZD& Lr8 NYURΌ=5u$dp*4LUW9!h 4 F. ]݈gMl,eOR65?^X9K#4-P5Ɓz^K2rkt&;{u8KIR'QL$m;?Iiu5 v<0"+Muq^)&ӅO2E#%8+5hu<\q)= cxðislna\G_zHelҌ֢:>Қ;1#G矯&^WMGCZ*捩ūحոeRpU";@cbHU=MqGz,e>:QJz{Wq=x]sĖ:H+12͟jyg\#.nKTm]ޮV7W'zq|uQR[#V/jsi2Y?M 7FSUUh푤8;g >*)Zqܧͯ-כD R}k^+ִˤmpbQN$R~u?XVϜcJrkkˣ0%y:GohITkޣwjϩ.$בxAAmK ֽԂ@:ZXImӧM(%MN[,K8I@[p2[8zi}8ω`6rp;{L J\ך֜edoXVݴ7v0c,;Wuja\zW|\?DG'޳s\ N+Z kSP!˝ ܏^ץYZ=10-b2`؜N}9Q/tfwumbC:4NoxwZHySm{OSgu- ,WrSZMs;ҥGj-rl.O][Z!Lza@jz<p\kϾ+5؉f%kLL߳FZqu]9+G}V!ۂ1ոO)-jd8g᛺v(+q^I<HK Re(Բ8cRAXƓڭEw$aOz9'Hfau#*Ӓ2fXj+J&uGt՝У2kIҞMjH>QEjf(pq~ $~;_k${Ozݮo"PȆߖz1)!M޵UȺxe4RUB+HK#*̇-kĿ1/kgUp"?|BI2O&\f0U>Q gMКkKidfv$8;eSHa;ZLַ ;8qedQedig 5_πv*Σk~6T'/>!1ieT+Mq_=#\Ava9oFuA^z k{prq^%UsN 0w5sQ%c>2U޼O2:kc4+u5C{H"$o0OZrJdи?ڟS^zP skơ׿5)8+7]ƼV_f}Xxzrv6cɬydC5P=j5.oʒcX^ԤE#VLOAU#u8=)Ihv&e χ[.\u0R6#"DcUAu9=F?Y!]?EcbzҴ@pA^#SYnmP95VB{ IH #W?^IacZYu!tLb,zWߪ%-Kh8|.!C:{\GMXOh21ܟ:+WJjT 7 /#]m*t9^unV v"ЮFUg5)2=U"xXVV'e$|5M*B)5PCUO#֦$ULQgxOISդ"^z|QDB6[׊׈bנܨRx̙so3F)'(ʼT8Ou`H-׺(@Q~8܏*0;2&^?l9סWwjFXV#9Տ6V9>X15(NI:H* _ SiE *t0O/UV,[ +^AIx/ӵFH- > c ]q:oCz # F8 >znHxti^D5xGÓk:h:X8`Ԩ΢? ,y'ҹODk[>cרCCG_F q810qc -Nz} >#z )c ^/]7XE&1wtBBGXJ/yc(Υ_uhlxoVmQTv|VuͶd\}ka$E{1cޠp9ϷJ%RGhu,^OqV8V"7) :qږIr);gQI=({u?c׈7~?5*> $mp̃߼5Ǐ9T b1!%I⧔`=jAѹ־+Hi# u_q-TqrfD.e) g{כo< Ȥ2 FӟmCԚ×iQK9ҽ`(>+a!$z׳ק,[y2}MԽU(~Ys:A$1,x8ºU/ CSHLixTV1J[p:?\-nTEi){*N3Z멹i``s]`x@@'~);G=UiI9`s)p3c'Y (=ֺ*~ (@ۦAtD5Ǐyޡk62qYBҦE{7C)$1Z J0g>]OCtPdwA_&Ě3_C %;U_^' V+͏fc ۟KM1!Id1,>z14s,Wz jގ)Cڱ MbF,Q3:Jkנ=5Š( ((()<_KiڙLGJiw-{إQ O ǰa]G{1OG"O@AE/C5$RJn裬j LM#;חxT匥D:ׯ2$`pVu:֍uE5sļ66Zky#h]KRy]?2}R`QJx~D} +bI)K%'I|D0\?6+؄؁m@r#LQúneFy/j6RZYI*Ďi\E)9^8QKc)S¹' 5ʢpCpDebW:!1ڲ8JQ1<Mi{zMuQyHҺ`Wio@BŽ)cぜqQ ;oSY'.\WWʭn1+մ٭/y#i=*p#< Ϧ9(@0@jT۹zʪVVϽR/^I8G +i&1M&}[Q7[0*xDĂ9z( Qq$b"d(Fyq\_Ve{w}zr/. _P\AƸ3M#⽝BA+@1`i*|C\BDm]9>m$+k fa?vU ܜRoD89NQݒ Q -a؞=xґYB9'.VR9e77u9RWIaO.n' kM/[@@wm?}:dAx\ZӇĴf._fGtMsZ$f?4HpxLm6Q폹cɫE˦*)SŰ̋;UB1܉Ԕ+qOZ` YT^ )HaڕZjZcW;x{O WQ\s^w{i7IߚT#eu.ĕ#Jɴw7 jhAI@8\ gz4t4xJ*I!fOZAxͧ,q(`ע$~4[#1èZ&yGS_N{}f\]{ Ґ0NG|WqӺI[m\2V|w c CA8_t|8?ʖ(E :9 ({;~( Ȇ]/O:wdۧ@x\xH?Z<9y Қ;l8SՖȮJy!`+zT;[xdx~wxMXz] K Ձ?0?ͫ'aTK஘—vk0vU ?ʲdW`%H \zF\6E8*qxɆ8n}NGSd@|o ;n˿ޡMўq ß%,|i+폍{)((((((((L}B 1N/TBLR9GtG?t6Gs5QhľP{NڤsӔwF4c׺dž;/m$}zS%2cFL/1Epݳ>m},Z[(-+{Ӝ&aisf=ι]|ohӒQb󏻎R` %y⻟|5h\2Ӏ+I&ݑWF %vsz/=V`=_ח5۳MNkҵk}JipZi#僮J8{Ӛ٥^si=p}nr->*IG\┏EVNP-mSk-#\qVS_h ݠfې/asA٭gMʟ3uW̏N:׆caÒI2KfV {flxs^.7pazuӌb˚rN=/:h,ʡ'|F{Ⱦc|C]`2+ lA9Ij/6sї0~ijK˻.35 Fm^E[<zb$wx[^5'GZ7.qVǝxB]0˅Qb Gc;0xw -\b@ lM!Mc#(Y\'ҵlb?/Fy'֒Oi+폎{)((((((((L]֓挎;Ԕi[Fhx*Mdti9?ƞq~^G&?~[[d Jtd J夽qguy*JmxXLԩ z󟆶O1J0BhU=̅&]=sߟeZqk#e .ǝV|r0<]qcb.H /W}Ϋw}(t}k.` WtN0QoV,0DQ/qcO&~X1L_r7֡}ƛ 2Kt#*KaB.SV9lN> ק=?rhWr=Ťd+lR+ar+*#|j~Ѿ99^% >V;WWr\L;&k3Ϫ v́qQ5ˮl4/6jTgPՎ__K ]ulhZ9" ƐZ@:$%:r"™鷐y~_ ]S͞?K][73ryC1i(gRMXt8/_jA4R!+l $ ǜ\.nK9ۥu+.YfM9qsW=\Mlu֭Q>@;֖Aq{ה__:ޱk"@^h0˅]sέMSIubO4QJ+_CQE ( ( ( (F"9`8}(#@QC+6}8?ٰ\tU q#,:=v%{d%J*w4Aw%j[HCB9 'HF+?NjzvstφpI+c} yq{9+wλEHNtǓ(ԕMӕTSC6 #;tk?\cI%%Xg#ڛin(ˌLhxPR@P+Ƴkq,SG>ҭwU#U+- "-,Df*>q p1 O7Wx]o G=kiE] TVN1g}omE(€%Tq_ZH2;Z>%̑.$'ФA(.[&Ȋ0Ęw)v)9(~e+oY[r־+Hs bO5cw/kLY a~|xF-W=~.]]*n|9>xZ5 HCBj O6&pEO5jtdlgkGp^)5|pr|&kפhy?YeXuGw?Rk^%+ޒ׻ (((((((((:(=QbVǟ|\ɰla^kp_X |Y8ԟֹφG-F{^dw³ؘıғJ+m{)+ե) ҐWmc>$x`Pwu &E [kS^f5?n|-t{dm6Ix26#SکyaN; uXd?tM6_kGYQ؜K%񦺖nu GZ-$H0vȵQ.ce2L88'F2=Zc<_vQ4q>o yǎ%wДv{W;P<1?9WWsS!Kp9A}p-le!]GzIk2̩w^ǘԭtq>4Ҡ萟2O>?ƻcB g+4G&zd~5ҒH%:SJA֊Z*B(((((F][hln$қ1K@Q@==kN'5čt sރ׊E`?a?C,:=a1YTWC2(Wұ n@. Hbzg>@ 5^rŰ`\?|RO[eP&7rKsIJ.~ƽQEQEQEQEQEQEQEQEQ@;Gtf9 r q E?ʺϊk.57 ' ^eEz_,a=hF)H92q^ymxS?L=A)F>kyII=qz37WOcμ0Ll\golm,ryXjnZLC=>mH "VrއTi_ńkw f*x5|/Ԗ)糑$]Ǧ+G>D3 ZMXjp(3\s\MX=ps׊]W1+VO9#J$O'Hǖq5+ ϊ$QB>RGN+ɚ=MF[1|;]X Ԛ> =zT{K׍<)ihv "خ$x31z1E)l]/KX_g5ܥqj< M\}s\_\!U=N7p+:̤_)Qt"xPn-tXqu a\G|%hvlp5`cúxuuBO9k*1f8'i$t=w@ELy%Pa蔓Q~+{qi+)U QH((((4rzSFq;PQEQ]Owxy̓?+]_>#+2k?C,:=qJȮF3Tbۂm܄o'!V:ȗQ:~aҿ>LsMXrfCt hOk2<}o nc WHcjdgkb1Bq\ucBjoN1c#."Q(D` {|?xFH_볶/VڪqqY[J@B]Rk^7a%}vQE!Q@Q@Q@Q@Q@Q@Q@QLQiLmP.6kq묈x۲l/=kde]z{Wx7zEssj6γ'R{h-Ub)(JmjӌZ$CšPm9@9=+=N{o $onln$m>(%@``fsg$V&JHMx^`^5lWK46sIo:Q=MyfU{{ʱAhάEvGSS:Qbr=kI爴'F8붊]ۭW*AsZQf4x#"k@jN;Tܱ95o뺽\\۾՟~"&-o2ʡ/kcr*wԥE6 !8>kBf `Cu5 $a.){F4 HӔjsEnM*ЩGg9== SX1(L^ii:)kCkQEQEQEQEQEPyQEQE8$Aw_u? u|m:d0?~~Yuz &3=WpKs53"glXӚøO+v}R"DPҿ?Y{_S&+_Ūds} w1,õ~{xFMWvav0}%6C?WO!X*޹S[e$ǐКvpyjF\6D{Vܤ1u$ۉ?-G?{lc#yH/FT6j.z5/Fyԇ.s4>5Š( (((((((QEŒ>R0ܥI`c{XB"g?Lc\宋<-UAqlZ+HT={Wmv:M=E<3a- Jcs pyňae@K ~+kZ0໹giFz +iUSV3F1(s\ (IO6`Ddrja+fvpC(?pU3I7rH>J:U5IʽnKm`A5|*yVUA Nkֱz1MW!ڷՉNMѨtR>bT~wFB އ$r3U>&8.?J̰.׋O݋f@GSڸtmbf",u~>!p.ߎXƣu#JZ](JVVO7AE^_ǭ] ǹWxLW YHܧw>mISk N3몡~FbҔێoi τg@Fn8[>!]C^d*Y1Nq\/4Gloᡖ >/%'Q+K[y;T$qڷc%s]roq_nԞ+8Rzt#) eq\֔=x%I8'Њuq]RyEOһsmrԊMX(L(QEQEQEQEQEQE=]Gkŗp̓t5KgAt;Cgd߽^qP4I{Ҥa9@+H#&ڿ=|IHLT>E.9 +2j/k SO)Ob0W^B$)?q Tªۮ p;cc#.!첣Dqnxs(qʺ\A@> qZ{]Rk^IJϭ%}vQE!Q@Q@Q@Q@Q@Q@Q@Q@0=*(c=W(ݸ*#5m>TD8r簫D\ġyaf JYūxҼ#7Iqk< vZ굫KCE!xQ?.=Wkn+|wYޒV&#ӼiiskuwWzfOV/|9}޿4/h@y'H#h jx#.qU9F/?H/ !sF1*U$łsG`{گes;(QEQEQEQEQEuu& X/|#9( gQmC\`цz~cξW<?롮<$w^s! `gN,p*3!$c?:| q~]OC"ב2wo5oC5 o +Ĺ>#Invav0}D |.3ȲW]o< \OB3;kGpg:7xFj6HCu@0G_@;kw?Rk^i)_I_l|k݅QHAEPEPEPEPEPEPEPEPJI@X+ }U`m^*r=,D$B19PYj5lZk,e>58u[imTc ^@26vJ^BĦARגj~#.Ȝ+#%\k5ѬuA#SIN}t=n-2J:xwZe :|͏gҦu}A04gD?'_;\ng2u~VS]ECg~h^[Xu0M"(sX+ѣu[ m.- B=7Nڣ ۊnMj\3n{$R)ԩ䖆׈"2H>D>hu{VضV$<lvTu1@a3]89nѹpW-ޔu*+RՔ?iY8X+>ئ<IRʛ` ~f0Z=垡nUe)TPEnlPFsҼ:M2ǦkiVȽ+eX= ӴuasS_SYDUCE6Zܐ@P61^jzl1Qzq(O^"Fx5(qg@|;aqed(0{KJ-cBxU״dLꐂ#[$ӥs^o5}}- <8;ӭ|DaB +u%xR{+G'+ !֕Rhxҧ#tdZHĞ^ zGd^K -TJުS^?g'j?J<bԏT;-tEPEPEPEPEPc<GEQE=$$_P25rx| q#,:=!GߨX8=߽9?Z+Hв5 +$Շ= !$dݸW矉.o fc _®?n3Wiѱ<#v3' mΈ#%V?ZF\6D)tmʀ}++4v Ft^8Gqҹ/rk?6mCԚ×,`=8kѬ.`(̈@eNWޱ M^2 F nl L.lcVy^ǓxRh( 7iGVML6F;kG=co/lfPWzV#xJJiԻOkh+:qҼU|SMFD0_^-ac9 <]tDcJ:.NLMKFx[Ǹu۾-g"d{{bN x~`E5vNZ{PꄞqedI<";uB2 yѦ(-:i$e/&㤛(W&]Rk^wF%+>5Š( (((((((()QE`ڊ)hQFhpl(Pm(f=U(}CfbQE+p) mB(;(EP0((((((({+7O5\ź*H\irO45ǏR8Xm=o"FU0*>LPq5tZ$K:Wu>es),FA=Hs-Tܿ{TG$z8ĺ>7k S[*m(.!sF~\z*u/7EX@   bwUp~P9h^d3knV87[58mNmCԚ×<4osRWaERQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQIs. 9RgKψR?_ fc SͿ z|]\LHemH9W୹^5tU#XHly#h^ 04I\61~ g>>V$ѵZP&1}sIJ}ƽQEQEQEQEQEQEQEQEQEQEQEQEQEQEQ@)tRy=è8aEPEPEPEPEPEPEPEPEPEPʧ@ 4PMQ@QC9lLj цz>+7B5Ǐr 7ʮib#"G&u8]OBāv~/5>?_ 荴Xp F:燉|IaTwh Ő'jn"Ke(9\H_M]/#pqedbH~\\o7g).2mBvB!l~7v?[eP&6)dXöi+폍{)((((((((((((((@{jH5k^sp݉GEK?'rTlwI5KXe#Hrb&ԕG J2=AiI7 6Bb(%$ >]kc{(QEQEQEQEQEQEQEQEQEQEQEQE=߂>;18udxw-_k gסj)20`zc k}CZ87cUD_0"R>n2ws_~%U3_M*̄ `_~%U3]]*e|"2CMA5z #TָH>xQ Y'`b ~ Î{ןu ~)ѵ>zHard|k%#R my?w=H9z3dM~G=QEQEQEQEQEQEQEQEQEQEQEQEQEQEJ( ؊qi<YWo ^ %^4x`+ W5xs$NVz$}hw{fTXJ[ ]-QEQEQEQEQEQEQEQEQEO= )()8?ZZ((2Gt{ gu?'CL<$w^J jq,*pVM4 J@&%rJ1J Ʊy¿?|BI2zs} .@?0_$?_ fc @O#݆Wgg3Zα7 p *tybFI" {$sB+7|lԥ_C`4 ogF}B(AEPEPEPEPEPEPEPEP{ɥzREQEQE`{qF1J >; n_k gסyqP/LEF rYPbqJ#cLΪNCu5nG fG~YuzajC)yؗQEQEQEQEQEQEQEQEQEQEQEQEQE`{]7O?5̊ ou̓FG~YuzYz~vx{u Ut1$.8O&i6|WSkGTGW痉x1/rfA,ek[$oz1ω5Sw/k SdQE8$Y fDIz~ 8Wqip)W@zV82)Eq8=X)M]s bO>'UH%КHPr /X?ʆ͸;)'ڸT]F[^nEyς)hu]Rk^֒I_l|k݅QHAEPEPEPEPEPEPEPEPEPEPEPEPEPEP *;im~*J5FNn[7)x;@1շY ѭ7, =Fv* (!EPEPEPEPEPEPEPEPEPEPEPEPWK-%\G5`z3]]*iWG% @}~fJWYK<\8EF$0y?5tH\$ŚF\6FKL:VONF$QpQq۽y2@PFבmS&8sR˷撾׻ ((((((((((((((( GK`+iiT|= k[$pTH6RvǷ5Il7QEQEQEQEQEQEQEQEQEQEQEQEQE`{t|uquxy#6 M q#,:=Qc`\eAPK(NdĮ3Tc_Y"7q_^%$U-˟-HQ0~}ĚC5م©AUb?jD^z-m>T1殆WfcF{82'brq6 ڜ| (1{|?xrN5;^w=H^WIJ}=QEQEQEQEQEQEQEQEQEQEQEQEQEQEQE0 lĈ$9U-S+nO=;kw#KO5WGa ujҊ.m96(@QEQEQEQEQEQEQEQEQEQEQEQE=f_xoAA rxdt5Ǐqwo/xL$,*Lg{Uw_^" ?:}o %i{o':vϿcm_>6?]]*k|_3oScSM>5Š( ((((((((((((((5;Zr3֧obIm&Y1$C !+| /0=*j[m9_,sp(QEQEQEQEQEQEQEQEQEQEQEQE=J m>: m2 ru?Ct цߖzѨ8|ld}=cʲn⺟Tz(/9F_xcĺC5Qd4UI3:Vfxu]tkq*mb7s޴Gap)QEQEQEQEQEQEQEQEQEQEQEQE`{cz^t:C\ܢ/kŗ ?롮<$w^N j(S=4]$s}R-B.cYj7} /247 OLT.O> JoCBj'C t=W)8 18o 'fqX?ˆȖFˉ[= C*NP8yxEqnxs#cBlw=I9z3IJ|*Jc^(B ( ( ( ( ( ( ( ( ( ( ( ( ( P+ Q [͐\wnXYbkzWv:e6»Q1bTkNNXWjjP*p)QEQEQEQEQEQEQEQEQEQEQE='j_3汜  \ q#,:=e" &AnX(s!03Vr+HOY9a_^'V3_)72:W緉dտ_ fc Tª8CWn ָτ GyCBj$F=GpK +~6| S*́_F| 5Qw=I9z3Λ99ƒ׻ (((((((((((((((X^)RHVVԔ68*6 y}=ѵޝ8$)+#]\0"S'zTl((C ( ( ( ( ( ( ( ( ( ( (=_2st:C\קt |uΝ5Ǐ#)$cΝ!> j >LTE Hpz"h<6~{z#w/k*@n(@a_&Ě3]]*l7Ԩ'cM]`1\#>xc1׿v2kGp[PA1x( uS}FWg_筲z_rg??ZJt|iƽQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEIͶw(%JZB "5MY]v:{RƵRI9f% R~J(J((((((((((({?uI:diuz~ |yi\xH?^͐G%Q4mGqȑdWu>dȯ xT/k"ViI`~{j_ fc ڟ^BdO]#Ԟ%Q [*my H; ȬqedXB6;f㤁W&=w+X#)@+?z6z_rg??SIJ|zJc^(B ( ( ( ( ( ( ( ( ( ( ( ( (P#_KSN[v=ݮ|ڤpl?6JCܻT?r/t%RttE{" N%P}5g^[y9|1'Ska_JK6$xiA(Z\m9Þr~6*Rl9ni΅g#Оh/+L5CmYqw/g.Magii>5^R[J jN?N휋xfGn+ o"fY7m銹y:eo~E/sj>$1*=?? ,oDPVt5'lJ,'ir8[p3Zwg"ByLj|%9.u_ZP&9c{ʒϯ_ZJd|k݅QHAEPEPEPEPEPEPEPEPEPEPEz( dgeN-.;lyNGn+Q.LMWZf;\)6^/Ӯl"T <ΛRGk9ElxELYDGEOm+PܟFZukIfigGYʻV֏ohR c{-t[x`$@A|X֗1i}\֯7Ux$[\,ezX[q((<wWC}!}Nѣ;~lUk$|azILҢ c9$uj>u ayNU=cxIT_a1d InEȫIb-2:W3[TʀH޷wWyC[2ǭPh_]\iYְ٭=#djͦ]jWq6%g8;Y[ m?P{Kxq2_l؅Cަ-:RrAWu8(PQEQEQEQEQEQEQEQEQE=$2?롮{s]?9d0?;CY@$>ՑY # GTFc0Nz! C,co2kĿ1/k*(āq9_0j}_ fc ?̿ .A^5tQ#ៅ+,瑩9dW*yXˆug>>W':: g0OZ~:I2FjlS&7ޒ0ƽQEQEQEQEQEQEQEQEQEQEQE?Z^quY[^}lq&'d;_f(!yIXW_Yj3y֓y9$[[\vOng3eAW6&|xvW*jڦupN`ID\x+Y`< _-F~^_Y%beŻqQ`Bj+*d?,^I(+D&'m:_$5؏iǧ4h8뉪K*3}fKז=)6)T>$cHcvI\V nԣV% *튥S7^RҾU) W-u[K8 ouP\qO>'ӀܐjJS(9IO;跹Ӵ]u[0Ҡ#_v;\Xn$[l_%U3]]*n| ێ,9yEi%v.Oz? , <4џh<6J9q?edT'w%Kdov<hIl@ ^}inF#[P&/{SX}IڟaERQEQEQEQEQEQEQEQEQEŒrA}qLA#Ypݮ ]U/vnt]Ekomjm(n`k iWf'V '=MԤf0U>Qg>Cd`N+GpDku^ץ^SB ^ou_[eP'9z3_=i)\WaERQEQEQEQEQEQEQEQEQEdp 4 }1ޱ'[thۘô#ʑrlQGR,Ⱥ۹|p}Q!(DU4$H,WLjf{-E *.-ӧ54:cH.H,Ɠr&BZ%եsq*ꚍ$Z[$.09䞜V'9nEʹֈNI~W]Ֆ_ Gګ?nkUhoNғ> 6\ ZX[awҹ/ hGU`;eG"u2\jZ~m!F*Ta"&]|JZ)lj`cR(%[J8#)?'Py!]w}1?,i|PzMb?K B TRSI E!GR̸8AUEwlێEHΕ|GțѯJshl,5I֡AW9[pAcGkaknx8;Үm&IKocYdqpmkc[_׬mրAT)tϲO1jx!{5! [oaY?j,c{\6GSdڽrP8j?}t"{}&),cFj-5i.vF`3["TiZ]1F8$`Օ>E( ъ7.fr+H7 M]Sh<ZF\6CnFzGj>6+6SFׯo$sA*_=y8ai~˿ޡMўt}3IJ|ޒ׻ (((((((((PFvCc=iou<=)~}JaQKb_뜎zVƵ qqnNTc- F[uhϷɬjCVK4JOfܱ}JOB9ݾeU<#Z:!Q}k ?GRAQvlxg>3mNKxćI$wW+D2<Z4g&XU-#jL,K*֯ƯdƙY_D~.#n_\%~sB>{گ]a|kr? 5)k<#brA6Coh}juS+)}U H FR_EWFVS{1wec-rcq]2uWVVT⥫lc(5Z(QE ((((( 0>]2+]'+"`?;C٧r +=z.z5/Fy̜~W9rzi+O{)((((((()3ZZL(մMR=YbpI*~VQ!Vv>::6U䕬qº]Wcjs˨.5DTV'?Z|l3[ {y|Ăob{IϯSW85|T^"H=WjuGSNq;ۢΩ OȽ87ūH~4tQ!{i^vVorxRj겓s]^Gb8G/ڋ]Ac҂qHG4R"'Yܤg%d<{l8uќ#iwSVOYHGn3PA;@\ZF3ҌZ9pXfqYs#!?(Q[ W u;*tgJbuRp5px6[*5pOE/0%Laҿ?FKTcJOk;HP_/xU/k >?v 0;}5wmJq\?…Y>P6 cBj"$e#*!«[/ȼmk+0o9>m wu^퉇'9zfQu*Va~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~Tl?oʋa~TmoFaf޺uGSA s;[k>> kF?]_k0_}~w!,Mānނ] Jѳ9##,e{k$a>$ՏܿGp; (LjQw(v>_ c!5w6 +"\WWw&c#lvK8zU=gUekVuRr07߅Lyc,g(;rngqBcX)~|#Vp!z%ejA | W󿽙<5><7TƱk*C"B]T{Gn u1qV2KGax)QN5O^0߫uY!Zk[m2g88{N/b(5 h=M/ `?~+3Ɂ*F߽G+Sͮ>xl$cmĤ6WLk }$]*Ūΐ@;Nw?'$hN6EZ|ă&3!LRE<6AZ62Jr:G+S[k2‘~f}[^DAA}ݎ_$KWq\(;}^yԟ |9Xu'xTDXuV 1ܤط*FW#8{O-odeMrvuz􈍬0Us"HH8'ҏW󿽇 G&:`j/#$y,5@/޽X{¹n~heHéq֏W󿽇 <8yubIӨ=H0urjvҗ2ݾG+SQ;) :ԇSo톌~)B<Ү1;'h⿝><aux:|_.I5y_&3p[,q!`{w?M?baWPzSåjף]0UgΏW󿽇 |2[PzVQtl2k,=kgGޤKc dw?[7A?6Pz/>pùv!Q*o*?q_W| 9&Jq~*|'Čv\? NI`jyoO{Qw?`O\2ME9xXIήu@`R\HOҠ@0Gax)Arut(|?oz_,e21ޯMِq?q_WXD}/ޟwë_RKԲ A+w?"B]T{id쾣P~+е!q 恒4Z1`Ň=;}^rix}XAf ?'io5$ɜj  G+SYX,N?"U{$mXu%\,R JYZS+ h⿝>8υ^X$X63!Ya:235\Zܕ;IU-FO^OQG+S;Y&3!y~v;8R/ߌ׬[DpvxJ;Amݎh⿝><'w VwÑuRq=z5[$.%Jk=LѰܤGax){¾Htm`3? ,dm#+"6G"0Uc"W󿽇o @W`MoL1z E@d%CvXeb4h⿝><xv<SJ <8ǜm:xA*#8u=0:riLSOݣGax)ŷ? (PN?2ATxge?{gQzgl7V`"29G+S?<:9d=1~ s9Kc0D̾Ob+2p|ˎ=hb>ON&/~F $V|xWTcYncJ7 6TgtV(jnpw(D񸉫JmThӎMˀR@$u |:YWޤ/SB@`tOV>rfAi!,Wlj U_cTs <*jY 1,׎/߃^V9arۑJω V2xM\nJUNSm!QKsW7EC; hF ]-yҡ):h+%+خx;5Q`C,"Nzm,;‰>%x %Q4H~KqQz=[9ek7 YȺTi| !'F%™e_-GznlY~TS{H;k۷+qک0gAoJyE?'GbP*Y[[)5Nmʠ3XRLN% 8y|CxM۞+VXN|[yV9׵RRdT+I#C<8n#|SI*ݱ-}^`sE(V-BM(I%H:?)˸sp*F|'xGvx;e~EV œfO1xM= U/&UW)S7Qz=xPsO- 8źyS[* ]xKKW95V1>9G#g 6 `7?r',8;%xFD~'~/o;<{1n; L&3X|V"օb#ָ׏MoCڅ)CVo;<{Z'2rKL`wV܆NwSR]逷\ >Ssǹjee$r[Ԋ(yxW ֲ%:pvr[ғLX ?49P;GK;wn6{TWgnVt&⿃b\gzo͔7T⏁طRNtq !'ҮD7#q+źpn- W!SRSsǹb cV]* {D?LߞnT~"|>HO9[Gժvs2VA1l:1u7?|OC–? mSq.Qz`smpUICDw ڸCOR,AO[*y>'NJ W9aH12*)Z4C9UoT|&7Ғ|[[(NpymA[V5`9sS)w-,-Hz=>9XhHkEƘf?^Q߳1+ⷁ|W`!#nJ>Ssǹ+I߃jXM",>`;W!u+lnǻB?47QsQz=ΥK<rOT M,O X?(I5H(J&'U>*x[)}Zaǹ"í~xxMTkC5?_IV ^.5Fxox#Ϙcf!1# _OڝVv)Idֹkx<"*NdHn=3_DD.$BAVPMz_ ?f 7]uxWU;guF-8E6iR3vFй,H$h?3U !u|?!ѭ5m+:2,Y i%PvFrh8'=3/DJm.#@IUREzQ@x~tl%,l$TYO^2kcmI' ~ET;sPkEbZ'f|KEab;tUU8  !uh*aC7H] K/-!)E)bp"GAPQE5ncm?sC@nc msA_|EP_8‡|S]/屺RmK|vR-`SUԬt o[k(\\ʱF IE~[WƛsGn4_ ^^5fu2*~v局OjV:WU-Yc|I?=={KōwFm~ɦyT>cIt|I?3_@oi Cn_gݿ\z|ׇW0]|qDE4anKx#e*Gb=+W6z>K}Fmmqy7y.}gN1sNm"e2:RA Eui#}2+V4 &ieV|t\9'If[-~8^K2G ܳ ~T  ῇ>xn]klc0 B^Yϝyˆ^ {Ozw[˦]4zВ8JKhP!y >v㿃,`VKƹ<4I@y=snOK &mQe\,>eϜbU*|mtoL7VHJlP>]ʘ >`vU|hԬt)нNum*>'cPt]_u+Nxʪ 2 k_7~EσBdi|LrN+W0YIAmi$R4YbxI&Jm.`hH$FC)A@]#%t+=NJʣ$pk??آOn>峳o<9ͺ0^|Ie՜Om>w$RDiR8 "OZ?|m"bK6I 88}+4xX7LE4 wnQcTek`*p>*>.Yw6GVU$$_WȟhھF[COu̞X_!`>'j.~[%O_@Mx/@IZk/EIpPP!_ 'xr[쑁E dvvw88`z/OqA%=LrneB1*cU 9W-+u-7S";y %eehGizωkHtg0|& Fp=_i[6kG%ahrnPFscqϝ~^9+=oL-Hcx.fƲB_$ #PK k߈<+m^oK)VhcRD:7($+(y6?g;qw寘>aп+$ۿ=޾٦Zhm|-)I 7|%QrHr+_>Tt$Ri7o$rG$w1?&<9bkl:5K\YK{?mRK#aH.py9_u|Pj0R,tWu\(| 0H|m?>%vu}as:ZGqq DN1 r+'هZ.+{ЎD@ \&  (|W?KgI~m{{|U-4&W oteP0cVr|8_,hZ6k6a=`Rj?K?g ھ,Rϭj N^=%r[rXb} ^u O:Ζ-$FADk# .Tg9<'A]Y>e 瓿 }38d6]}k`%}COqOL%Fpc-f>Z<%G}ΡYM iZS".dpw I+%nƗu ^d.FŔGG$ےNk?}bISNmB;(060PK$I%0pG+<_dTtekYd,&H&eA`1- l>usSAO$AXyb7zA{W f:Ii,HD /$~ɴr xE*h:W)49#f;]Aɓ`I=^Ѽ~ 47H4hM֝iѢ[^>]쪬7,+!*}zx=ΟJPqqq+>O|CQ.skk =$w d#'#e(m?sC_|_mhhmsA_|ֿmh+(+񯃴/Qi'uS Β,Hћ(T?|ICG?-O6|̓qIsAExV/x [i>'kkh 3It?7ྃOI}rLP!, FݼPi⸹["LEƈg<0 dU~~G5oU?vUBFH$$q@q~oxYIVhx P̠FÎA(T?|I[o 趾>B6fm#,ݓI$ρgX|Am̰sH9 -dOZuoiolf9~ŤImdǢ@5/~tGn6[C;] c)@3d1<A_DfeOWğZS:?7pinGsk*4؄lPTmZ8 =폠˩M=wr[rm]3Ṇpq\fxĚ=޷k=q,V~cb2lg'ڨ*}# UX`U¨E2N2`r٣}R<۾x[1tu9(|!>|?܋3k(. Wn NsǪAyi51Om24r*I`x A8%?E+F˱HpH ^Ui, e1 1V =>uz< Il-nmJ,U#X8, DŽ<#xzQVڅW7S% &߻cnw`{-ʞ?"3R~>eqC-A$6Ckި-8hREy xS\_i?bԧtd-1^cfbH,I>nE5vuUL+iH'9c֨?g6H2-n3m9F8啰^a   5P~h5' rLAw9-x ((m?sC_|_mhhmsA_|ֿmh+((((((_{(zim ڬW9R* ?:%1AmqEHmT _ٟğ_S?u123-T,Whlkφocں[XC$R"Faz ٿTE Bu3ml|y^\z;E{'X񥅶kf b S$@g?xZEkxdg܄^xy8ݻkh{&rNټ'Iʄ(¸PXʣ+e^(Xt+DWh#XK+!\a oYj/=rUp~z8=ڌp*4rbu@*`2 *rUW ~>֭Hc n# 2++q Í;UjP~p>e*Qnx47ď|7}WHu[6Z di7r7c v2x <b<\Cy"1.U.e ?j?.&_% ^N- p Pڟ-2M:ts6qyA(؎% f8V h|S},ӄpCVmrsݑQ}G]GRқɻ {b yN ¿nm/ƯHe\1 - aZ>Mc!iȄ}V(cO2Gf8?=h2l&_I#_>)[Ty"/?x'߷if[}[7]svssAEPEPEPEPEPEP_]ɶ9kk6C?4Zɶ9kk_6??QEQEQEQEQEQETէү'{.Z/>@o<.こk࿊^OzIu++m["R3s 62/X3R{ WlWii VC;!ٷsq KڔP;unݵ 63M,j#P$ C>uH WOXL}[_5Ziwm " nQȯo:̚''qkq<vPʓAr3 l K2\ N;ďqХp1o^=5_߈l/Msg*~XS@>>'O|wo[Dђo")!HRX5H(2HI y6-}5EQEQEQEQEQEQE5ncm?sC@nc msA_|EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP_]ɶ9kk6C?4Zɶ9kk_6??QEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQE5ncm?sC@nc msA_|EPEPEPEPEPEPEPEPEPEPY޷h6ujv:me!Fr 'ƴ+M}?o&}zך|w8u"eDQP0`rI,I$@rQ_=\zvq^8:,7˹2킓+NU_>.C4HMuvPIڲ0;*hި־6j[>ԯ/-05Ƌ`_ٱ  TQEQEQEQEQEQEQEQEQEQEW_mhkMPm mh+MOm}@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@|cxs\|g6whjEgfap9|u']τ⾛–Z_ A #I"μɶePs6 ҼK5wc?<:e2\gA|!tp[ ⾏ Jnm5KԄW'U-IA93'=ϣOM&s^#siAz&mg`]'Cc[h/>v=$F`x A;oZ/l>#3d}9:˝,4[e_jp7dm9=+d#ɹgo!'Ï kUA(cpk,cgbJ_<3Xo[X"6};PyH9;_ۯE^ =k?4ZFAY$Uuˌ̜mzw<x?Bҡs5 r0 dP@~Mj}>]FInA.rTnI2?T_=|P|W\xno5).,Ra A;g<r@=P&eh8 UBTrvww0YMuy4P[B$R4%IϿ>1or;khi,..hρ6¬ˍ&sɯl9~ĦmBGp7X sEɩpxߊ,pC0K0RcrO#hh|,4xWU IB nZW3GD.HIb1H?Clt^,nu-^gZX j# X| -Ťԯ>'Ig,S5lV4@bCgm{Wߋz;XWQ(oanF8y w`V]ojZ­_Mw2B8ׇo)}w4Bnm9T&c )W9trc1sG9Ǚa23C1'&EMaxz}k[YҤE, xo_v.:q'Z0~Sˡέ=2$(r8-yQր=Von}Y?}9&}0VX=;~z??}*_$lP_݅*r⿌z5?6|ZӤ [m=I+%n$mw:%IYB_\dѻ0%*[۴A*iWT>_^[Y'u-ȖwHD(±>9h F,:L9y UO'<AK]`XtPlVfǜBCR2 Z(5/> $ 2$$ JRUL%݅;MWRޑ 躏|bkr*v澪<V^ntۋkyf{FQ! $)pyV⮙']7Mp[$a+oO:ߌ3}#znm[c* v[ BA5xOĽc=׋:VG#ߔmTAnIωzWo -` |"a߇m=;ƶ4pNUJd;O!v(F֊?Me5HK5 <(pJ'f5~|5m_Yb-ķ6wp$PB[V%#P?f6u/Ok &wSmmIj"@Ar\?V:lfblP۪Uf+0r<1Z([o [YgX﷼k-?+#p@ iouOR>#vea7 bdb[s2۽jj^ckK;q*tܹaバov:wxWHgZZI"yll` (@J(ʾ)|=5~iy:j C*$Pe|_q}Z#5 ņɭ Kʮ"H~vX6v6ߛڨ|9DNJ4_L.m܏DdFRV7+4e|*+[IL[TnG#ֹ>:Kďmmھ\[dV$r}I4x献\wL[DJğ~NkI5fvR;BziFʩKNs2}~V@/ xF}jWSwLLS\JE᾽hF.ygxt+4Du2˻,q݁淸Rn&`L+F㻅jľ#4cw64s .'3–cq]\15Q4ԒIrd1$ڬzP@+Y\Mq,匩WwȬ-pȰg^sM&+ Y.ǁpr! .|[~Ξך&& D|^O@(Zem7pTGF*s^w49/.9:ӂT0 z8\4(4ۏ2ܔG%b.y8,z2%+> 1F')Ǔ_ᯊ5hzÈ[% ڏ.y#~~Im=IM}::\|n΅U?Xzk#=EMX0n!Ŵ20(j( ( ( ( ( ( ( ( MPm }_]ɶ9MOm}_Zɶ9h(((((((6|}"!HV%F.sEn /kZ0Ln/yNDX"n2zs; 4]ck[ht:|&])IF4RPci8^6/%l_WA^rW'h @-hCN|;TzpsZ?moJއ#𢡊ǰ]8^kGo:-k wp٠v 6Л:=m/@Ȳeio(Sִ(((((((u55nc-tW55nc ( ( ( ( ( ( WUMnn!cf<Iv& pz~Ƽ123t!Xծ RA=?.+ W~ArzokOZ%޶&3KoQl֔"py ;tKM)#;!̋#'OzYբQRwtdY69?h|pۛc2^P9x~k/ 4шو;7*;}}k~NFϹ> 68mt,ؒx,jwְ";V}r<֖+#zO=(gc ,ûkg7roiQ$NJEPEPEPEPEPEPEP_]ɶ9kk6C?4Zɶ9kk_6??QEQEQEQEQEQE5F%l$2yA^^ Ij;M'MPP]5x7 9VeBZr!oY͹HSqt噢DK/G|w$`$}Q1p=&U &J(htCx6e_'x/5އ~l}h2sG^}+d/kiI/-t(h~G8n}j?> bŚΤ43#/Jiٞ91U;'s^a tQ\m,mqn6oul tz!}P֔YFP ::ƇO5Asb}*3Xhu;fYr&4f=HZ)"xAlҀ>QԾA2*ֈC1gH2s_MV[{d}v.@FO'G<*Y$3`9\P| sKd(\DžnqU،0Z8UszV9r`g8O3hw)00(pc8p+bK5hfr\! |/ގ WgՌp+~|b@5%_*+NM܆yt4{-Z)j})}ؠwnyu`PQ=Duk]4v3|#i Y T(;\h@Fs)tegsz֩TTC yx %GzSQc*rXW;/tx$ԴBM{P MjͨA+]L1`JoZ#S|HN~*|]/f767,Ut= gּ垷}s̲e\Ӷkgi< %f+^aay6&mg 9 . wP V8xj(H)&@ sPzב~͞%ZDrܡ#tqm#sӌc4ɤ9 v*֭UKiU((((((+k6C?5| u&ۨ _6??| k&ۧ((((((_Hg:E|PXYܷlD4spw*jlԊB$\T (c2E6NPlH|VG;Weޟ$r/n3 WMC?αdKz*M[&e?8d\wwwypƌW>-sI")IJ%NA?6qy KY󝣣|2߱0"=f-T&cꋜt5g zegeJ1xvʠd/aRtL H䎣ڣ߁db4>럠U[O'4QEQEQEQEQEQEW_mhkMPm mh+MOm}@Q@Q@Q@Q@Q@Q@y?)Cs%oXikZp3-Le9<75wWL.l.ЭͼST 3rh4;l'i לִѣ";n0GKHJB ~ryPh F˞׮ ;XJ#۷^I7/>T8זV9,f,:D<>8 `eƫmC(Q@ltVĭ WqF36;@`bH,ˍgM5l4*{ۖ&*Fx9hׯ$585\E5HHDIp'fO~}sƑjAkkOW?0XL=5VhȦ3#oEc 95 Ӧ\E=k7|܎v#{t_֥^x[K1]gcpJG܀1ހ4'!\9p̣@G~yp }PEPEPEPEPEPEP_]ɶ9kk6C?4Zɶ9kk_6??QEQEQEQEQEQEQE|E._GŶJ`0׏41ۯ9f2}+z>n:~@9a57,4MvIUcO-xaqh׶[cTݳfr{Vl2? кݴ̙@W06fs/%{' DG,w>ݬӨeLgMe=_'ˠ7W?l!c8#S#4zlZ%/&Fw^q_D|4mcn>i;μ_ѾG>Z֨pol6ǜn~zM  FA o.[`lL#pw('99C:Uޝ-gfQ",A;voBI<N+:b;>pX|ܟn?_FrO. ߅-͊` ߱_=w!z\KޜDLM6=UW"ىcy8\<}z|WΫy d c'ӵy/íFjZ7ͩR9Nxr++i/^yf+AX_ g%9;mϭ}pܦ{׀jeS#Y^N$Ђ1p(_I 3 "HB$W]/:!eIdmT371k~%|(5fK(w.ؠy=k i-" -ugrLf>*N)<62,ql8'?Vk]>唢\ u8UaO6H)q.[+2:.l?hQIZHX0@`J~<z垕[lD^t=Qor]^vqO`=k ,~^}ϗu #=OzE /~K-K`&9@+Q@Q@Q@Q@Q@Q@Q@Q@| u&ۨuk&ۧtW4QEQEQEQEQEQEQEQEW|AQ4K17E>W;ewe8V'tLϓq댜Qu+Gdr+ϵovb{F#%P(ψon~&>Tx5ib:o:~2k_?_Ǥ';hft3ۚ7͜H7,*9ր>еkMsD|KDלOզ֮nε]j-N-mG8pq z}|WTMKVP-*]=㹇hU>XdrBWz R臨OktmC\HBN  Cx^ gt-{Mԯan;K+ @98ܹxC麟MIpq5WtoD^)χ=L.,$buQlk${WpW<'蚟2 vQ,|VaCm+᥮uiڽյk-+u$v7e\|mm pj)uKO*#檐J,ŀUhSuFjkfy$6RJe㝭? 'Cw:nq)r!DNw=,|EwFm{nMղ6b~pw@ܠһZ{%~/[܉W0AtYU|UM0)@Q@Q@Q@Q@Q@Q@Q@Q@| u&ۨuk&ۧtW4QEQEQEV/Ux;FmWĺV*ᘳEUPYSڬ_[hOU1IiVI@3 [|{gs!HQ`!2Z\F0XсԜ d-*RbimW?4l^FF:|f~SKf4y2l^K[%{i:8=́pϵYiΑh?١>${__i)|^n~rَXHqg|-/Z}MM{FX0G#|DkEѼWmmEmprP~3.0 Q qWҾ^N}IET9Udc-U$VI9 xDxb}B(ۋSy H`JIXv`Y:}Om.w}lczZU_{ hf\P+H&O4^@$;pWsG5=6ϻy,mA"A' 'z2 +EKk;ۋɧUX/6Wi8~wjHб; {o῍1yxqF:'Yo*O y,Ğ Hh|1j^5?kZwʞ_7B1sۊxw y}ZO嬄;#PYs^+*B,uɹq̈KU;w 6NrbDg R0v/j0Y W;^^xcV"Ly+$Y,Lln ddTN+ZF"Ү ^TAV!a;N |;|A Lywmr@"9U  FĿ jz|P^jߋX({òFYVP;2m@>ů?Ym':V"P7#q)#q ?w$mG_ٷfq|׏A>K3j^!٣$Ud|rƻ}~:,m׵@o$hߴZFE,r7aNzڗNuYOѴ#1|UXoZ{w ;kYXQC688Rz)̺ | . ķKIRѣe-kf.uP;`t5~xMt*+F&tfa3T1_3>?įW6$#8Bq,8#8 xZO֝}帍fP @EM[boZ2*-rKc/Z@4Ǩ<-2!P3!X|/WŽ-FԮ7|}14AVNI4{yUTs׵K]Dm Y&X첋H ϒ]J d>^NI4ֻ=G~+I#8:dTZ<9]jzgmzeƗ wFYaS=kƿm7? l4pnh"x ʬP=;;|PԼ+_2扩^xʷi-P1jIH c .z ]Sƾ/|KXŏ2(LFUA]|-ny5]xozn{43A渁3B+,R"OK_Ķ%jVd:Ie`#,1g-B6J@YiwVVcgs|]Wopl`X`gZC_>%izVjx)-[0]aYUr΅ArYs㏅^'ikw׶Aikk&%n$嶌2ch8?MRLo.l_˺t$mJ }FZ]Օ?k>@$9e־ +_YV:fe=C0{D`Dv|2}zNu-Ck)ڴJ7 %{Hef$6}5E|iņ(O跺V7,HeWFQ$puJ͔V"F|ck(u8 v;)4Hc_ 0;}#\@( c /d>c&n8o^3Ƈwʲ6x-#%zwš Vn]b71m#q5oZ ,o Ku(w ubH€P+}?Z%akibln2 oxVf։&76]KvD'9WWxw7J,!+[[4mp>R( |$_UK"x{A>6qD$,|cp xs*iЁ"V/#r`P{ PWuhxkD4+maTKWQ =ί.Pi3}4Pp$6+xtkKiI.}H##M$j,(з>ֲ5{HV ,iæ67WvFу0=*WZ5ۏ3θ6y76ܝ6z9^5|u~40Zi/.y R%8h&&3"ώ$_Z< n4a]K3s BS.֛iZ\vev$p-F"G`ΪC2: Zx/ŐxL][7R׬c,c8o/p8r 8 ( ( ( ( ( ( ( MPm }_]ɶ9MOm}_Zɶ9h(((((((ƾмoEQL.?:H VPrFn3k8_|%?ռ=k"4i3,pv8#8$tҼInJ)l%'*HcEpkZj^QA,+P1*29l.zwkKXH7j9f,ry|s/4KZ{jyķ1L+T+m|?kOj:̖ZM|]GClv;^&]z$ri24巾[aoP> '>xU$i)f1AZ [d+$4<:y:_mڶ;xY08]?y Ӗ?_bö?g۾|߱}\ퟖ=P)Q5KE=ޤ%̯s1, ~W -C_ky_¶M49U lq,{]/'K˥HZ[$ɕd@v35M)~[[6A/u)̖1 A m,)PʂTzW>k^>E (}hC,Uʈ[m-8h^5{jOߎKBk@-FX83bU¨ .TߴXxZM|kqRc KflJ>`3r9v)]Y *0\av1ڷtEI儸^b98g>,ks6]R &Edb>hdQ+Fm# ޵,W_nmLashՔ=~Q8!#|9OVQY>vZĠfq.7 co > xcVдkOGsmKN:ĩq6.C28%CX<}*[] kzELv#!U*FY'bgUPEPEPEPEPEPEPEP_]ɶ9kk6C?4Zɶ9kk_6??QEQEQEQEQEQEQEQEQ\[RLjC;R+!fǔ<]̪W'8ݜP~J|]=}_QY_ΓZ1|!W(1^Ajey [>Sm] a$RS YMj|q>kWXPm\/?ku_ᾥ6^tFc` r M&{*}B7=%$* &m9f8_"YcR xRH#n[dfN$!%o>eᦉgY`:%K Ƣ7唑 <)G/-?p۔^Mͷ#8yN/M; 3saW_n59˥ml(§ljہܞjEQEQEQEQEQEQEQEQEW_mhkMPm mh+MOm}@Q@Q@Q@Q@Q@Q@Q@W|x?k[wգRGdGF~_i99Z+ ~)𽦡y{H#q%=$/4ȏ .Q$c85?h^$N1*RC,2Il\-xY}RwXX1?5Oh4'մ"T  +_~^$t [cf[erA! WF!M[fnZ7H`t<8\hQ\W)+ľ$AAmw&Dl[ 's u\蚽sysᱍᶀ.BaS|UWbi }wS&jL["C"Ii6S3N5&Pwjxmw="ږŕ1 V<%@BQ\/-xi>!עG bhII\k^^/T12)ހYFUs.ܹ*/^sǬf/L[}oA 9vQEQEQEQEQEQEQEW_mhkMPm mh+MOm}@Q@Q@Q@Q@Q@Q@Wco^x4uExѡI .c>Uc8,; KMBI]V6nYX;Ak㎻[x)π||W 1mDϖzmy%|=5:yBfVgQn:þoxŧIm'NY*xIB R~^Ş.l5"KhtRl3j]?z~VۼH.I[rG>eegim2i ?.Wp$XO;k3H]Feai NNzmŞ׮CJY3UH |+u_xDsk.&saf(j4fHyXFKe,C*"L"? t>K-2][4f}yrBr$m*)W]7QxSoESt$^Í%K_xP>>xWVDK/Im$HwCbq&L@~g-j<}||=;PkeInbScYnB+[.NMw(A!C18YY4h5y"=&p޽b nVBI[o|a'7&Ld,un/Q%CU <-sh6Ln.]..<;K(E_jn9$PxC56_e71>nɍםi5_Zo4>+kĕ,Ecs# ܨ O+BFj>U4v;,d&)el@kŞNkj3em8tnr1Cs_ >%!$̿|NFoGO?+z(((((((+k6C?5| u&ۨ _6??| k&ۧ((((((u/1i^ :8|ąrs2ϞدJ>E4_ᾧ?Kxn"!%q$A+61_F-6M֯a.c%XfT6 slZQ@0\|(<~,uUFMլ&GḊ~?"Ao? |Ej0:o"Z_{٤Rgcrx}AV(4 й3o{3nPKgEA+FݦܗL,p%Cc5/ÿ&lQj:E֡0Gx!c2I vWO?ֱi^}k3 {ᕈ7(cu"Y|#@x^Xt}BNdg,U*{`E^"[Q2YX;2dƄ*739.]|_|Bl+ BC1B%]8؇/ | MȺMP &st,sd@*Wu+[xO_:.{mmŴ +CGhM-YX[᷌uO&3MMiS5'rHU-(#(PAO45|;/4JU  dƬ$m(iPp3T|Ɠ9As]Cs6gJ|bq!uEyׄ_z|Aشm8&_4^IV>gVMgn#VI &-p3j ( ( ( ( ( ( MPm }_]ɶ9MOm}_Zɶ9h((((((((((5%;M'-t[>C}FX>b1 t'?E|kŇ}_HhRkހ*mVnrA9l=UQEQEQEQEQEQEQEQEQEQEW_mhkMPm mh+MOm}@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@| u&ۨu^ GiWjˬ6JBz±L?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$?'4Q@k~$gķ"Q_.JZz:o]Ml6qjd* ~4q ;,`EF{d+m) mR0ZcVX'K;$ub1e|Eu2yj,GJ']IDɣ$4H;@1wmNax$ VMq84_nҬ>9 llR"2 J3z>:y瓓ڹ߆-ޕv.Eb̋.J `@ Od>xt֭pXܭ\crn]4:&JQ%(qׂGxytmn-$y$SJ;;wfur9&7mZ_,"m4gJ|W56l 뼪j(".Nӿ@3—i:%u]ٚb~#e5kuQ_x TQ@g#+D| 𼳬յUUU%ez0P@ޘOPޢKiZ%/ڞ2ȊYgWv>;IRvk<ζ~ֽ?xI#gMM27VO_Y Lo ̚rG2# A#-&7tKc"+&XXݐ2G* g;O[vX,]БԂ;{ZvtvjK64a 4c(<.MB$R r  2vh<ۯ2Ar@23`Us)nR?b@2V$lb0 9=6Fi4|cvV`pnPJz`;Wl~A v>(,+8rs^Osdax <#-z`o~3YOumsOgsk#C8$ Ho[Ka%; l9*+{=EZEҺ:\ڂ*8enAcHE ?S*մژh/H "_a+p'\߃"j2pЉ[I,p;ϸTt?mipMqr!)%e(#8 G GQ?I K8ܪF@ 4 پ{կi<-vƸ 9#>,i=S[U%aɴF[pX|rF+̾)īc(8` '9>+`oޤ"RŎ9) sAȋN/Q&YaDW_k2FqQI s_# b=C, LeX`x ."Q`ET\`} /~ Hm%3(.\2INO!l(h5YV7Rʞy8UiawT$}E "{K=BC PZ ,Ί۟}+=-667mY%rrF* r2-nQ aj&I;K)bCO<(/$m| ^|(,Ҭ1QIjO[ gsz 1K RSq/?#7:lʈ#2ɕgvT7_ t'7wZ 2/̤a{:1,iM[6ecIqT 0Ni,~1xnXnkHO>{]ѶFp2@ǾxC^=ʹvf,*p3Y ץ:y_u,@p dg''ޘήO~TG%gKsm$RJU c>MS*XX]\+=ђhaXY [ :FJ)Q  V'sm>i6SCg5ɄډdXT"4n[T`1,3YkmmOysu"T. @"rYM.q,r@랙#Zofat7@>(WT? +-Khv`p@P"|GS{1E)wsV/O|-aK Y$$ RFr*[Mc%1iP#͢kdJ(8gwLDүNnVF`Ub+np-׶90Ӷ.C}F[ߖ1OtiñiZI utpaN:qp Ҭ>+531ll&0* `3 pIim@fy"2̎# ZMi 8|0n[ro$~W$_$hr'дɴ< 7&u0{͐(J|N$ ֋)!1c:2,]s!|nXt׿ w)db!HېGf+_|ƖQ1Ǩ0.]'-İ1Լ+t'\7Ϊ3%GԮGj{[X7V<%7h۽|pxiX-3|Sq\*xtw \;O/|-uu3JHr鎧֐}QLJFIFHHC  !"$"$C2"4 !"12AQ#Ba6Vbq ?-x\.nlM\H>|&걩Gfl"8 + VʸSI69HCzk?oN_dfU\"H!>| O7.kyni.A H!o32ϟ\fEG(5TTAQ!*Gf) C4V[:"y ]x R ôlr-gteʂZEO*R0pRe֌\E'y<MQ7P1IwCnϹ^v@T\Uub7^2)J+0pG9s+'+5#Oe*)p.'Dn>Ә{(="2=WTm[aq+z(3!Z J-ۖ 埑tY!@%79 D|3"?T|+ YsFUe%fl$,YQDط'e$\G0ҊmpVK8*3"!~v!>/E cXxJLv툘wDJFIFHHC   %# , #&')*)-0-(0%()(C   (((((((((((((((((((((((((((((((((((((((((((((((((((" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?M&Ϧ>t$mxѴTi֜pGIa2hUoμkSPT[<8I$k *RWoء.=)~oQȥyU-ٗͰN)J|O:RTh_-CrTbKYiesoRT1rTbKYgLӓ}*8ϐʑ>1t&\¼S'Bߨ!u@RTbץ}5JӬ'$gX9b5CO*~3GP'?ص?kV{g6fZ#F-? Xt;,Oݸu9z#_Ե@n'GPI=G-O/zn]#Oo5NYS$z^$]~@ӭx#TUGP'O*Z?+=MMSad[*D ZjX Urx pG^%h??/C?'G-O&t6uuZX[E{Ď ٌBڻφO[fIfo2e-$m'?uoS*mǩ)M-K?w[Eӷ+![Qэ^ ݀ d(^#uHCy>?W3ԫEWП>:.&fyuQ !@I#{‘^k6zQY!]V*GDhkoqҊǼ7׊/f=ϷZueҾw%#<:~{Yo]Eq//dvR'a@Mtz$ J{-엗wj(8$zШWP?j'ٲRR0Aj(mmblF2*% Kf G+gn?0ލ=ŏMGIjHcY,S^ [%$Yƫj\]5.RX\۩ST\!ťԒ^yM%Ui~k>" @2=@'?JYk68n]Qpf\Ͼ:U{I,= DSc(ڔSQLQ4Ta}X HOXj%Dmdܣso FVM"iD"aX {3e[Y=6NQԘ>yElm:o+(u1'ڬxo5MjE9&]z;#NX-Ua}jhWWCh^s۞rhQ}奆on`kN Gs6*qص4;m.BamۏQ8qKxש Mnۃ8A'h1m&F)ʏ; GVjՎ#DÖQ9Lk m1ڭ5{{G<I""G}s=~AM|H]r(5=K gvKR@``9[hjY5nxݛ{c|3@`'^z~IG?vK5S՟_C_o/idCਯ1`}|h du?x~!]C=~7j?PԯEW>QE[SQ紟"9i#U^$xPPԞËV3&/b0Hn9 s֣Ѵ'f72N[188T~6%W ǩJ.&Kx$SR}g6JPk90&n;zǭg%^$Pv[s{V7~;?PGLvxATR'{u*4{65/4y/wA22\ ޚgS5ǜ;`rGOju;1B0>Th ǰojo D G zROFR_KcgI5v]"fbqVbifQHh1@ [AYŠ(32hi(~ix\^8 ]WOejoOx|ZU=Y?E^uX#z5,1>H4 ќ:Wy\F?7}JQE}EPP:k+9…9556GXм% tyW4r<݃q/agor]" ą>Kq:Ŭ0Ej-D3cc3zfxoT7MSBS*#l:}j[} ٮi: VhBœ$~T7[j/S{U3\Yfhn&%$:ZtdK%9zE$4Nqi.=ޑz1Zm)&h`$12FH·ꞙvvr ԑxs:WDv9*;) (\h m dgZr2!Iv:UՔx>ӯ֮?ѰCzϰz/gfᑷG]FE5fwUA$({vҺt7kq0K5sKX |M.ְ-̷Ro y_&p9/K5k96fD>yGhW7GV) YQAtkSIŠ(3 (=o[ц-u lw|ٲ5VOިPqd:OV}}C~Gh ~1cWtzN ,+5![QsƯC%%CRQ_BxEPEPEPE0,2+gk= bZ( ( ( (=se f\O{?+;R Lwgx޾:OV}C~GhD ^%cRrl<>4+,hw+ĵO _?j2_TU[E+u{mE92+E(( (=o> C,8~єx*&z]C֪͛?ֵr7>'ݰ6#5S՟aC_:д`1x x(kuO 8cWhop17\m׉q}|g5z/*vo8 ( ( ( k3yx=ʠx'UWQ\pUPƺQEQEQEzE 9;q<<~Uv1989U'gbi\Ʀ[BG'E(((IH\?H<ֺ߆%dg2Mx% pv _[ꧫ>‡!#|K ?tϧlqZ8$(az(!EPEP|7]Ϸ[o0OީQ<;Omd޵r>6|O{ _[ꧫ>‡!#Ҽ9Ə#<+![QsƯo9=oHܟWjƤ ^O ;7}JQE} Q@Q@svtnԒJ==w wkhJffg֫!؄Ur 'Zn7ZmN<.E . FxGj((ҼqmqE\gO<g5'UC|eؑi?128J[tH]$o7nP j_3E,9]g6Ϭb9Z t·^<^IzI.#]3U$2s=+n RxrHӃ,-A®Eq.ؑQs(zq{)QEzOofzr7!Oxv`<{k]?E8ēgjh(܇?kTg=z>G#qn_&0qWj7XlLA|qzƉiC"Re|ޯfNv&^Aޞ<$orq8Xb'k,/~~4:=d|׶˫đj64jY/wmO:}]N9,@=4@-dkatb{[ZKm[Leu+0@ mUdSs}@ O&5m-#X"uqQkې J' Ƀ֏x/zǬM'o׬M{Θ?6v_XIru/Qޏzx'N1^4}gj'^xE%#9 K6RT(27PFGι/(z+kivݨt:^[]CO׌H*ZԥR5kFLISAFCIS ((SRCS0PK\&Aoa,mimetypeapplication/epub+zipPK[&AwG& META-INF/container.xml]AkB1Cث<7 IA `<ol3ߌ^bW3X N>n ɛvLzT "'Rә>`bC蒭gzO@8 "vЀM)xgk&?Si1w'ft-iӾPK\&A[0(OEBPS/content.opfYn6}/ /.qmo@s@#LߗdKv)vD9s8:Z.G*QU$@ YVApJSi^HXP,) *j].1LBe1I(RUC(8H-RjVW|%_V̻x>Tm4_W~k<O}3<_x_ocðððððððÈÈÈÈȉÖmqV ~5L@2xݧ_.qt[ƱQ QS aiGMNэg.۽ꐶ`GIkMF6:sU`7nw<PK\&AcsN1 OEBPS/toc.ncxے63wP=HF52E^u  Sw@dI}>Ie[d[݀eᓻ wu,Xu,EǞuJzOeL}sUmEmt9NmP`xj_i7-C*j"+Oފ|t߻%ڶ}sCy#tWqT=JMyS %n@,2FUӥ+T[&!b)u أ| q8?ǔܓ_"oO6t ] tI4("шy5Q-U&QوzjVeq6idQ:e$r:hQk \zc:ڈmBrAl]1<t\k_O&#L`P_*0&) ;|3/z@dM*;$0АF|"UT&w$ 47]2K D/(fb`62m2PUXe`.3}2 B3basUd2\f3cdUL*cIɣSlF UlP)ٌi R2X͇`vY}%vQiu-H[n*7%b1,ihn'MJMgC2#o,T<柛?PKR?f>9A9  F b̌J L̂0H3001132 V6&fv cdbfae`dVQ24r SvJbT4qK@] l"HHBSB-~۰ [e1v5j6pO4}>&f%V86Ԏc<Y~xq`~+ůr1;w䡸e'f5N J=YٕmHOՑ|=!IF_*u7Ӑǿsf-Td:䞦; gh+%Ɵ+b+}*N .[r8馗lL=-WA_Z)Jk=16;>0pgSs㮼yGl'i/C_=9=ymM0[~>W@`p V= $MME݃{DǗH"Dgi31'o!Abm9'v}ߧbT$_$/ps{tTz2߼??j&Uv6HIgo=d0Ij3' JR򬝨>>:@# kul>ڪaDY$ënQJ1Li_#ͦ>;*ԴLbV\9J9@+?g@Lo[8zӱȜO3Lg1% ,r,7RMITaR7^vxJ#dye=C{ZP#x7.g6L5Ǫ"S+^ :!??b4!=e=e&0#}n ~/wtm&9F9G4ͤפoM-P4m6qN R%b:]bE,*Vںe[-{37Jih) ҟ.^M&z/]HLfb٠EN9W!cuUy=VΗC_#T!&%ffm|X;<^)uEbVUaBMHřWjrzS_NuAc}FDƾx]Uݕ+u?+ M!zZ 9<<ׯ}uKI]jЕ&+$FϿ*iY躂y9y*^" qɰPJAv|@WΐQMerEFR&ߐ:t3Zibg31Rl?]X/`*I3enƋ #ssGɳirJ OH>Jjj)f,=O{FFѣ+ ,,V]OxWw-ZZKKS%}EYXL'x篌UІ'"җ!S%NӺڰf\ELA;J5 iediΧsQѧ&fDD0,ߜknnnlE Ve*yUd o/{=n;8?_dOzo_İ3ۺC]zcFgWJU ~ei?Q7K֕r.M)&a_qG By q{*}wu|(IS0N嫉|I `@qR~!0\µoOu#압---<@nTho}s 9'p$/Y"g*8^w]S(ER!#Ifvhi%v6Jp /qfnU1Kv0wL>[kQ30({pe`F i%v)2TĀ yؚc@uK'1 4Ƀ͹..%ͦ=VOQ=E,QC)޻G1^bf~8V4wnErK͓{/4R:/_6n~8zLkА;- tM'j!dE<==)))y;zPT<5l';CEFƼ'p@zp.wM>% ӂYdI[|?I ,JG֍w`%k"> \ukkS/)>k]]/0 5+&[a|IW^Ő]bWV"$=V[L&DL1v|)OGGbcooH7k$xU[Pa?N/w}ElG2AltU@t Դϧ2T{lL?Z?ujgr~TXV:1fw۴eiiiv6+Scc#EKՃy?zO9J.^L?^_G|iclܝkJ(rrMs`WBUky>|h7Id܀ΦJxmζ1nauaĐhi?z($U6xëN! RwL?δƐ#k7𡡡ϖ>՝}S.w1Q(%x{{R0yn9"+MpqBRup~i]W1c!INwWGIxyyMA4Uowj|6~fi̢[Ԫ+C`Y+ZQQQC7AxK"A $iS'Ǘ,tVI-h3~|P+q%~̭ڐ(E3Pbz8 ͛g3R `\z)|6G4z{{TtԢXCck8q0a\( $<`g% Osm,B剅s7Fg-5QWWww+4#uOESab++K-}rҿu@n#)BnK gԺJꈜlxvXg9HPȷ^.mKF1KnGGG+h?[LR9_ jUl%72,ЋWLŤߨl^S[[rb&>]ibEf.gBPVx9Yxz߳g;0WDḄF]UDӘ&ϝ;,׍P__$8ux{uqMK4{gfb7o4!cu@j>>ǁMMM5n5`ѩ Bj%.i ̒SR29]E|}O`666zt)f; <2))(HڌVI띕!=7,0%\m":\0v%$(79 ۏqČ]uf=\@ FϜǪ$j$q-kv:ׯ~zddb.#Mà?+u%_0[@)ƫqw49/g?jݻwO3aWy2㩦6~(_uX^$f ^:-,ͫ[t4P9;%HL2Rb.WQ| l( ?Ygj@m/USi`BeK߾}SM*AH'{i,<3V# Ah$^9/ï&CH|3󬝀RWԌO Ѡ8ZV*ReheY2&!*j~g s ƽDXf O(ֲPKSZKQro*F%6g8ʰġwSyn޴3{Ofddj.lɠY1rr~YzT 9LLφ=dp@(}m|f' ʠqjMtqrrB>){s(..)c? Ek3 dƋ+V#D_o zz(,RW\< 钏80\\\I*[E_6?Oy2Z-Yv2 =n_ͺ(y^kY2 bz/A5ؓ> FJޡ`~cui>1ͦ`ΩvAr"""BBBRR!S$MCȭt]ebEht OJ~bua`?*>|0 [a0B}:17;=QH3ϞJ**f, UD3ObD\yEv$N X0n˗/`p5B)qw|$a0 wYһA!oo5Nm y󆍝 L`㬞5kɰ|Ejâe&Md4\*|\ې˅tN hqEe0 g;!%%%3ltLL:ε+,֣G>H}TEC]IA3MFA=MU)_WEɡ80 ;kP+ٴQ97dfec$<7!BNi }^% &Uak 6Y @"+X x3*11f\QI!if|(s]VFߩFhpc`DO~9»IxøA5R2-JjN\HsVr!doHgMo6e Ռ-tM$C@tUP9lν|2^QT&/mf:)?'sY_c0 ...W.*)*jjwݝzUj+gi@F`*4ɳc*}2K.-tS4:ɹ?y#~8e3KB#C7(A#p&\Z*]ҷX%eUsjpmZ$q MirD  NjQr "}}F-ܸ!ϟ?%`Ee".-.{Z;MtUAB|uuUT"lj@|$iC 1P2hBB oqW񙙲XHRooDMOw58fh7BLKCR΃&=pH&,ZW0q@興EG4HS<?Y?vQYkdN 4f/[}N:qAAAʭ晍H,([nݢ9)# ġ!BBnyvBzjGG3KWN |LgNG2-]/?;E<$ւ-aOyy 3섂e)?M9W30@o3[2Q3A˺I#ᵝ[UE.MKH8/~tꦒ % }.VRC*73zn)ssj+U$,q$`I*ePI*`LcpWǏ/O.lQ^ŷ.Đ 0ƱRZIZÞ67mvp <U/%.i{LWҔN U,E4xSa;;wHHYnsԷ/Cc433 S#Z\\dُm3W&de^ddX%t(uv^w#,iQ%VT;r^_B'(3A-~wuT+?: \qb8E."0 AD480hdph(AEy}IQJLkVڐ* zGt,FShP&YTpp0tf:_Di\muHS|^RQ~an.hښR44?q9 ֨4g,4eW> YIxHδxHjuB9C.1 ar(q`!SGG}}/m)C{{{~ũd !)faemZu#E5۔a_o)c EQPJGye5.ul\_K} LLA1BLLleeEH$M 0ZѴ.(. . 4;UxE4ZP~-//a?Re,t CL Q mr;ڸH+;n`o%a'--;bbT?/6K3b% )H W#|s߼w4E/Uge )V]]/9OW}SPPaKJF}K] qQQQi-E>.&V!?r2zKT4kS:-mg` V59&yzo;Fk\yY-D-tܢD0/Ta2e OU 433] ~;}?[#Ϙ6:, 0[YUUpxH&d7J p9stPEHk;|veF'd؎94Eę021ʨzB) uZl\,2%%G:nz|ia~Q/Rd)˓ hoxD*=owjOLQ!ebgZڲ5d{J=wr;!p?24|rcP YO/KMU ?~GLF:U.oxp`u ؔiřb~ȄA_N!^_.PSSsyL~ɻ7H֗V39t܌tlthda:%N.rF=U`(,'E7 vclS&Hrt. g5M)23S"9Й/f)?FZE1MI) 84*}&&&41{eW=j`Ve#{TaаЍ8!3D.t;rW(7ot;q7iIMuuN-@+_1K"7zܞ储IB"*׎;n`gsiͼ 0TJ{|W@g,28v9P Lp5|/qVi&'2HI5 Yc5(Ƴfq(f-N/s0b[q[ k%fZ.-*e 7 )SxyD|?^r|C|5fTN-|(7I$wtˠ"}ēg4WQK!C2Ĥlϐ&/H82tOCu/50Y=JW-mtU*ck s%i,ɌĐ%uN=|s 9Dϟ=;/ôdXI/J96 I3 ww++!bZȳ,yyY Уö]!V Ysx޵j`%ރ~_Wy#J*+Ϫ"e~FY=R+cIJwvZuM8,u?k d;̙![,/xVe^lIp}ј6ए3tQ#R|4)/&·$xlh҆E:ߩUr*6;fۿTj09gm9x2gD]UBYPKCC&Ay\ksOEBPS/Images/cover.jpgT/@HsFD@ACr 2$Qɒ *s΢(ف g9|w}[fMwծ~{׮V44sG,Ɵv'B{NtpO4ep щ2x&H eH%/q6V@@|u w} ]Pvp܅EQGEl vDEde$XdD$d$@$B""/vmŁ=yd^Y ]Dnuh߁}ԍTwm#\q(sE n$[apCR9|ѣT'NҞ=M}p^ 8r%㔔';Cw> 8@MDLM #}&Z]h!!=HF~m"k< 9@Jv(HMLJ#Lp͂/ .sh)*vS3RǷe+w UҵV!qw{5ݞ㫗S=3V\;g &ojCRE;(6z8pԖARq 4$l"#5C۝HEVb˜ *rZ \T G 20{3I&1q׊<# !kIL뎷<(ö5UVȴ~v-g;0WQO'-i'YZ{-|?{*L;nU" Nݡ~0U}cPUHIk-fIp8` B/B8kf>ZTJ=ZCEYiA~bHu08qΟ\?;q{yFĘܵd)EJzRǽR|KUוHh%ċٺzyg{@<敎)^w1 \u0^tIŇذAH]{ڴ`ޞ~)[bB 7f{< ]=1Mw0sLR#b1j-PK#V tb\AGm}?Caȗ֣Sـ5XMv({6Ȫxw*w8px#' КweͧO&'pAئ`@&}N*N5n8 9'auͅ 6mĞʔ{Gn &nHYvM8 `,=xA_)~T"(LPĤ+ht±G7UlKǾU{g-n]I0{wfKeg>7V{Թ(*r~pީht,uMѻc6 &*rl 8b04R00Sy%IXgB/ZGMԀnͅ[a߸=7En@)~|v*7m-Zft556$Eę\s84![RR*Pm]aw\7F2z)ARK4KqBU\s[J=)|*l, qK)$0eT=\T_fY?n‚{bIXJq̖fcv瓗.֘2k*ϓ,WdrV a';[fQ,͕NK4†abg%T6q` GMiU-Tonk%Mz/-WHN]_/p[@DAT!֒| ]GJFo^/Zwlg) cZMC6%K7i- 2z"rØM90lJ. _I~((\" :<e1 MwC,#KvCM>lqyM[k-k4)αH܂KD500B |faf*-!;hSپT ?|=?<}ڟPGWb6 ZJJJa0w1aM, ;|<5ȟ1_37F§' q1x.UvR$,/Cy?4uxG樂 ީK{L9 xa>J[S&δd3\@Rs(th46JS(Y8fZ66NL#]SC#Lc~Ʋbcf@nƦC3R#Nj6F'OCRO۾8pi4;gZy):u9K+Y"xN/b'mm׹c[H!ͲWo&!*  ]b,^n Ï\/s C&#'O]?[RzUѕu0vadH}:nnnٍuN/r*o|ABrR8ƫ.3$Z &'vAS0<[)8p#yopBETtË?HUk+Q:d?$[xQ_đkgl366s屢F˞M󍚞~zN;"ѨLĀ*uJDG4&1K܆020[<,!CJl0粳r!>b3L13s54 CZ M׼{[[/4:Qœj6LaOKJ6D f)_5m= :\)ۂ荥`OJQ@RH=zCm beڿi?3w\F?< 26:\ ^X^6uEJ,uGzLzo nmVCG{&^ekY[0y5[>@<;|c-ϖv|u7ҌI֎8z@EX LD2.;Z%xMVrJ$Y }rhQW5ZX\Ia=9sh`s7^HSYaIk}S-yIղFp8YυFC>c\F`vmo䤲]AL>1>Q0j럑˶t:g?5YEC],Si=ϒ9N4DZ>otf}eIJ0=uI'*0QI*Qa/jGS_nb8IMQHkՒrLmKuSpWuu`Xغ. +uy#nLޞV,j="n|Y9D> Y?mq/VrCuqlj~w8XGH>煢ws:6d1t=_h"mUM3= tK2*?:y͹-]佥㟒P2de'1 9b$G9Cgw/sojNYі?m)M\.tXdctz#iP:k\\;Rl7 M?*m{&$.BԴt7r?{̔2ʜ|Y7U~wsr~z/p~̿ !Z⍾2tdo%5 B7շ>2;Cd] sofŲ1RkTEe+a^Xdpq]ȜhH8ݛb ϫ8c2فQDz"HqbCwq$u M7czX\<|%"A]')84*"wB٥VE .%fYpn#0lο}#-WB_r^3{Ԫ/73aґMPw+d:@?6i1i|=C-ZPvѴM,jm8Gq t|^F R4HH/=bzN!@h$km Ȭ:D╗OZIh!Ew_7Xſ{tΞN{eU["k×w.-pGɇVp7% =_Wm9 _޽zjOu'{ WϞ%Qs BL?īqDQ\vLsuBY[A;q!a!A!Aa~aIQ!!݃ fm#tiWXc5[[Tf+(,--!"wuwvgurXu K.[+7}`eeuwwzxm tۍ {hm͑` uk";S i* u{YA@l, R2 nP k_G]7O(˾2Wpk(^ Hx@y~!i~! ]! qaQa~!q;]q0]`o;[[ݜ,@aNPA{-3ͿHeĤE%E$.I) _TTP$&(yIbo{cw6 ,G<ӐEw snB𱌅>-lD?3p*؂%{#,m$&?]+E_=&/i;B<+{=ǯ'53xk >5Hx&9HHIHH$;x0! ?|m !%%'#:|kb2DԿ L p~?@BJ| 5_$#O܉S4 Z>.n7ѓ?8,s*D*r$V┮GMww>}^"t+x;{GRv>25 V3>*kD\6{ihvkbRRrbbHt!/жt[Ss2RU'2.JwOFU=+Leq]r%m 7OԢ?UwA??8a5Ƣ4ī9`C|oH s9ppvGEܥx["B=zd;pUx2?8Qe,z|z:h6?-K^An\.ODWtB黵gkC[YAf袛˥ؘ.9k8 Qod ko=O,^yWp2e*1͌`QO0q^?M4hAZz0~59vn轂Nh5P5]m87|i֬z:}!s2'l%},|%`裘\ϩcJ7wA3QTOODWtm bJmv#UJtc]VC"< >0O[r1(r DCoNp#54kX#y;ICt0@ 1eJ!8q/“YyzAVD B8[ȗoZ:.z9h 9=7:4?)r#!%s|7\brszhiPg" KG@·֋'( E@35@cQ)}8ߠoD5Nh$"@ ͏ºV{Fb"n׿Tľ+9vE\u859՝}UA;P(JUu$707ЪB=j!NA3+jdn~̍OIxCf8N,@as7^[ʶkיM}_Uàh̎5%7^A1 ߴe3uy^nL$I.])~ԁ֮ym F4-h3qC*A~A47,TO_ b(*!>s w!wP#Lͫƛ6K&?ӊZjռ.H`cw!bM˿1/7d}8J#0w@Eo[y˛  k .Aij ۊ?L#JMLz Yiku/*!ڤ/ 2t<`m"v^@_Yn/מ=1SRBw,uiw5ɍݴ&~Z =`ѻq7)+M>zP(~qF Isk'^ѓTus^P(""dâ >F|w=Byo5iS‣ޖx{b}!H7&_ƾXOҦ!9>?0>냳"5ko7+Bp% ]F4l Vqc`Orn7*\:܁rf3y/BjsV+P#~2 uGpMcułS!cu{6&eFM\6.dͬuu{[T{JhuSV!DKoTƨe8|yJN M%wG|8zܐ֭yX$ 0RMVT7UZ䋘 ׊#/+j…lɧOtFJ,Y;6eIhI_p=hxV"OkSk*1WD)@)C?V1v@ƣpm&ίrkjO(%ϯ ̗T R12 : Dw)n԰ 3Z? AA2ENK& %;c@ҮoD&zǪ[!V*5 zW?+Β+tLzD2t}B޴b[F'džz00Ek?by$4v9W;CJXށ 7+5r4_c/JO];~]V-Rn_wϔ܌UD؃^+&ti:j@xau?8\0IunNM?]Wo`1NHj%_JLSwݙA["d~r0$F )5V<9=[ӪWWXߍ^]fuL+^{y\EκjZߧΎbp@zdk 5k> 8U<ĚƉp]`O^[}HOӃ'7ZDJ ܴ&Ю'U7cݬ:OwU)әw.>u$e*&3 O靫^Na{z xXC?oظie11G&M(5EA6*~FQ=~@bTCOqk}HCijv8Jr;l Hˢ~*9oXV]JE׃&9|owA<3͘P#![k$̫cO( ,7]18@(y*l>M+d $_ŏgMDgLumnu./VUhlr%4= \.?խU8 SJq&Nu /g'R7@fVɷ73櫑X o]s@L& T FXOF5BHK yt'6! ށOς/t2`<CCpz 3I >IS=3A=G<#M؜͉zokkց~xcFr%5(J s-XIɕ@T߱\P/D'#ny2xTQ ߋ/yQvbkw|uZIZ/%1}ߊkΜz䌱?;F+S  0l2!,M{YYx`gsN׶+A3eHL@0xSR%." c)3Ts=,ca.FX0_āk2M5~|KQ5QV6!es]C}1BOL&^ ~y^x ԾI=@55o,iX0>L$YݓD)f<(99]_f!r7 $wNs/{Y3RFGOYGǘ},mnuSm:Xsp'q뼦KQt?0ƨ19Q՚7~HW}=01(w'GziU%frz>&뱹¢ !jB4g{Z:<t60hhd8g{qw sꔑzN[Mn<,#ww}4_Dur*yȝ)A̹\ޡ>F h-6WWpTyxw廩WWÓ"0 `3 'M!DFt ú!Vr.NWzLE2'>Isj]yiVS0ߍ7#HꞭ77EhrtudJ7_GW_S%qbFٵ 4 ,}EQmD $r%fæ^o2Jd^OmQ.FUf: TҞu$-̉BO)t%9~]t3Z ii)ȊIz._^y蝉yk}IMnQ[Ϊk{T*vjgqMXp0K/Ovpݍ%|>|s.'Z4'U? +6 U|?SfMBs½Hb3Irw(yv¾ >vB UK XF"D5d5LłNeۑ,UnudcPk( v$xT hpj(3 PNaGҬh#{A-P^ GcNY; $,wٱ3A|I 4J;ga]/.hc׵񦚷lb vHsӞ$Alj?GD;g|_Y;k(iowYcpwI(_t%ntLVǣf6i_^pmS 9εCbtƎ@$K$6 hɲp⭛=w̲JJkK,ĸC ZJWe6MjeZ{ܺ3>XP؎\~(?UHwn--zYsЁAcA/ Ӑ󎹱VP zq#we+ 0m1ڋǃVoc\J+Zf*jUĹ0\"d7MhEYBkF lW͹簨~:g&m쑺 '7|>h(|4)% E% qSt5Fjſf{5aG] I,tzƘ lefxC*dg C W7!bTw29tD<9*MqȁmE}v\3]jU*F+7y*Nd '$>7LC ~u:7}R55^@6Sk(#LOtbNy/*njoE;6XF~:%hJ{mzb2{nnN嵧H pfLX(x{swk 7WV^oVUІ 4-6Dg&QY>g E,{SѾ!d>{eg =IQ$h3/" ͳ2֤S }ouO?=;q}lY}IIyGh}.,_ԇ'K촇W< ,8wC!.øa4wZ.)IDp08_bf|ϙ3Aq0GxRM?_zߒ)U~E׷Lys1KIgy حyqۆA<+Eز~~ٛ22w0:h\J_򶰩Vn4Ȅ7tFFM)]CI/,70 P,A+Q.r0z?3Ȫhc3]{:H4WJ ٣)9匠 6(8,Mg#>˭54HWT~HvCB7-J- #t&/iS$J}l4 Y:==&p,jsTX0b!Z74X1S m9~7GiERiwU(JZ'>9[wTZr؇+TAF GL~cl߰oLTzvs/QRag# #bH)mB$ާJ#?!i'f&Xp%ռj0A{$҈Nډo3kd/BP8KJl"2K+ -ߣ:}7C[>7,SMQ ':d '&d%KArqիObI/Xxuܮ2+_BV%?1Nx@Vl;im⏶ Z 敫1#6h Gف0֟PSs3FZu1Ws-|>?P1xlNZj`8Ǚ'+Wf74{# foi1i)hWI9\j,G}o$7UޫtWh"8&]>[⾼abgem畔SɗΨEW|̜(Sd7v110ER!g&ǹ&AlV[REF^yj+Sna䇮oflr*OOv|APP#g@Rs2h>od̗-ɣ *D^:U[&c,W{'=;Ugf!8m:gFuIϦ>`5x!v}- 9r?moM"8?](xi4|o@"uu~b%O{?k&Y{PkOn9h<+}~~jboÛBg>tB/ġ[N>-SXK546\U^O}wu D\:O#*K,ƶsD{M(?p;jVaJFBfFNz|1Ajp0_OM̏PE$\ 97"Uv)3Qo*'gh3[IYLBC&:.UJ͓^e2l˟s j'4/6z69> E\E)g eOBQ޺) ?w.a>Z. E[lΛd@+v,OHV#87ZnD0>OVx=uUmy KAj9z5(;j:>n5了/MmBgKְT1W92x^+I60yME+B'w[̟h1?Qm1 Ƅw2>.O-۝xnHqk.q*ykL?)˨яH_qD+7dtUV]X':T0 r?k^~k#n8|WL|Y_f]ɦܬ 6G= k܄; @F$ӄ5|sPNV3R=S뎟 ~-vj" 2bFJdBH;F*#W9UJ:l?۔.g|`8Iyi,uz_OR*Ùq@bZmrC9DpKUo[+C R\'ރzkCJsu<{'_RORnmB~9ȉ7.GNLtyy^pezX~j$:<oH{83=5cY$tD=Khbkoii=|I74وvJȅdzJlcN5Gߢ㧫R SbG{TKQQN**zz-z,/vBh3/G$JiK+QԪk *y$_{נt[xi] (a3A6$xQ6TFd?J%mY ;[m:!bYVs_]uUK'\*`5ѤVtKoǰZcVs{),biQdf~̾UF'6%=޸OE OI'?./[ԨWLɪBG>u[,LO< 3n%ƫW_*qj1LH@{ɫ&.@%c,ޘ_%~Q? #ŠMY*TI~;<=UNKfv6n WrpD#[= ҽ#˹A[BҀG%5ӏ̄v*Ajѽ+i::ŊpwwsDX1pJ'-<Ӿ^~Vm= ypܪ F-nG2'>,ubŦЙhͥh]f23_! /,`K`sPt~@9##;D57{c[]p|8>%r4E Z /,H1ݜc5O՟9h>p n=61tһ@׆F?(0^818V <(jaUL܍A'yw}z ##aM`U'WT#qa'q&rL[XdPyHb-x~DȶrLؾ1].||\$bw`>N@J^o<ԭi ƴ`F F 8&iMIY b?7j3ORlI2_PAҀ4붗Fwӫ+1h,W@c!J\ehB+!K~[d`5?$ɹ@k+̥ݭ dg$Wc2_EK_j=, 0ߤ:6c;{ܵm|ugkc!S2+S_BWP}@-a^_톎pkpxI|~"QAdVŒ(.ӈX@Ҷ/C#? Ӛk¯/PQfvع Iq- *0- ;w[/& <` p268N$S K'fٓle= /S 9k,j1Uw}:NxPW>?;uzЛf9 Z}%>tޫ6:4WlyO/9>~ɝ)h-i A 3,TH2ў5ީXxSq}~x4qZ ]We/Uy0S VÖpp`l$jhr܌STTT6Y1jXlTj &krO"kBaAs89|:Cfa p!&$^0+k/Phc-mOrĵU͔`{xɑIhg׀3~ 5f]=]!T3m]aG)zϝ`Z*m;?]HqWtNC]ڲ; \xx |dY?jxc#^36Jjн›Ja'sN1Lw֑U4ⰿ̯٤f#JxEuFjWy:Ax3skE==31o7v_:ach ;K5 Ѐ3>REWғDבN!Nw2'bD-`<.h_YG\f]i%/G==BqDMP#o:,|!G:K=nAr_hyl^W%^HQsd[CT=o6&U 8(",Nōq74ЈkJs >; B-\k eL֚Gd}|sbpyt9*yZZɑKj1[Q^Kd#fg?ㅝԻ=|1L9φ%@c;mX4K'CG< X(x] &!|g-iw.%.ma)k´0&Ílo ^eme|v8 \ .|܇<|v;'>`s?KiXWkWQ3xJVI{mjv,7dlyh$^8zUG?Z{I(7*Yv"lopz5%vwrg "#^' UF-؟nKl#SQ!%dȆ[D꾅"΋u_%^cj+g]92hX-ʆCDip.;,_X}<Ȟ,[Zg/XAWq#P1&G7#5$֡43۾lLʀ׵^> 9wS o;Q(0 q8[+Ieooza^9SiX/R|M3ig{oSȘGosD%vr[n6*Ũ=Z`IԷRIlw5s 3бbqmֵbI+MƝox{m\u Ⱦ[ErZОE q֬;/c?EYpE[[9q >Vt*rG${VU]vrڤEIjoJ:tEOe#MpyLp4/syabr"32NY|5gR)͹!?Vy/YV yaDwOE>A ǖhl?mu&dKPhqYЪ]DyEHͩ +Y]ڒ}=?Տ`ሾ{_5&pGJԘC#W  fzuӅ 'ylL# p:/]}YnkՈ &fleU({U:`KE j3 ] u1Vi$xWӇ2 Љtޝ.S;%)IG/P2 x\u '5Lvx:%|ڈ{,,͇xE };n}VTt%n.;Z3:Nt` AiŰ,>Ru ŗػ[o#;r׏gnM7MCէ@^ \hqg_ہBv3S&"Z0J ƚoQyjiyTjt@?as֐u2CeȦ* EI}@$ Z;(~+w!`9"bql4NINv%./-U q2K˝3yy ȡ'DEKr-J%4qN%(FJ NOR, @Y->b?tjI-uGwrFKߡ|_y#Ŵ~{; #̃=ӦH[`r悳$e<2_WI@W5{׃TxC R NUh_hoc@I1ϱWS-z|Ok9qo  OHD2EmvF˾DI ; v*Mڃ=|`:?|Y<ӕyʾ)mНj>5{ObQ,Q5Β»Վ0ްG63ZBS@SO'bwK`*vB눦!. ׵ _)JۛvqVJ`3u +FdžmT'pY<DK zzK.nb?6V8-/KӬh%[ЧKӆzQj8WhjPG)yh>͉+QʧT^ -lcX ^U( hp~2K7PmHp1N mWw[ȲI2uY@z!8\bE?#&7~]FsNMnEan @"Z2.㤶G:5"AirC.7[X$ 7( =d1ڪ |lބ?43=ibdYH*OO5OُL$ؚeF,kvzv~|LhfaoثWRZ?`J1RUNpڗaa{VgܸkΪOD#[7vS#"Ab3ͦwwU:'۬d D%#ך&k+ԏycy_.%:xc޳vgEu{ohi,Y"hxjl|u\dFy]~yn (#2:O@7OIPhN2™yF0R_Nb4VD:TM'M{q=0dv:[№aHC Ҫ]ɻצu i ")J `}uc8Cjׁg\#6AkX:<-}S\֡M9-frC*46&vcwp%\̈́w#,YAس͒]FHy쫏o@T^t$Z%[pIKV>[l5µQրS5|2ؔlY֒ĭX k33N:>y9t9yYÉb-N-H.p={|8Cc&R֭À R:z*D:W0Jh#>d>{Gڍ *۠@K)WJQp1n+bBJn:cU ]DwߙGs,,hngB8<3DWKP%Z L9QK2xژzϼR~ ro0 |C%eR5ʐ m:}Aq6txI''q{ ۅ8]Ѱ  Fؤ [/{2V"FWau3E2}(/xΉĥZ.ָd7Z2uR`I-n`}u]C*Lg-DHw^~c\I\R_RɎ+mɌk Q=X%$/D.e{1RE/E/ Pkoo,G7;B=d0imϖ=ҝOu*>8fDQMGa+'-agNu`-cXDld..2vۙGIEd;8^$?IkNv4QPPR ?iF"5% _'p>i9mQUL{^=-vx+߸67w1[⫩%6vY a@v6Vllγ=[&BL&%/g.$u#7f18OY$ Jk84\o~5`X\ w2}&iUn4ħ.J)`i-$Z/ݤ 5,W'үk2J"MCe tSӟ{5#?"#ώns(?S*gOg-+na߶Zhu(6s{JeeWkT&xᕉd]vA?f QرcATl7f\7j:Vܱ:{y謧K20XڱI*նwL4BR8Aqy', q7lrhX6GtjyȐj-,@FD;BdҚ_U!IЋtaZ5RC׼]hb/y1k=>MNuQ?E_AU?sTZ؉xF >%ijWXkPG箎/8Tnnۀxd̄l)qљB@vs:ؘ1۷6|_DVS&(͙ ,$HD Fp.B%0-rFsBA)1H4KO ˬe0mВ*U*]1raUWNw{3%5?$:ޫd uL~7 \HXwEpZd*KW'4ױ8'7Wф݃ۻ~,D&,Ɍ͙vМF^͍qY8?n+8iT6Tqx%~W`>7y ZK( >(&˾Tr YF~$L#@^>iÛM@mVɚ>b1F"Khhq$~JS_;dY~Jy _~)ԤCulNK=YͬIKΛN9+{V^flW>rJ'}CNȵ4d)qfzm \l%ygDa+%TՃW W :9Բ9~Dbmx+T͒ԽjK[;(Iw:T{s8-af!2yA/npOmK5"[g|51 e~obk ˖WGH1SDn;r-aCjGY t9,^D ;;lS6cTWzxiJl͉[Ɖ~dzj PüzfO];2*> P?Y_NZ1ppu1n`Ny19y1 RL17N{Q,ؐG\n2…H2O5؎}8X*MmnҺKGT8`Sp΅2ڌ$Wx޵of"Uʽ.;ޘ ("UB3l9]Lȑgzz]/a.NաL%6gi }`gyD ^3+rN=[֟T}-[Ljջ"? b{a(52W8.j|5Uf=\!i.Uk 4s9#'5 豓Dn1@[MH(ob2 ۄn|áE!ߝSZM"7aJ IomN7wU/]s%8?9e6 cx.=< -V'-V%WH.&<? 5?]> W/1w%\Fm\P?F? O|63gOŊF S{G1ύdk~n./ YҞG7e켋3hY-`lώRZ<3AVeR^.ekidv/3lM^nH'b1IҕW6gDWüAR`!DKچB>B@-c/^rˆ725}e32džR]|\q9HP8e߄(Uyfz*!&SP%dcU3-3͈9{C>OKC|*N lls]FHĵZ킶V/3Xk p1$_6҅l6,$ "+&D=R.!LLtӘb};t3c8bJ`4_@-/iXG^raMreo $b_%,)YJI߱imeZO8m/;,C[m&HT8Hښgms{յwbX$NJ6+AM#+?@,JFuKaK,RD .+\Vrd8_JU|Y>/; UK& ?]O\/yx=kQCY8gI4dkZM(<.o X.-򼪙cI6sdHL ᑾ(6a9F+݀2zt|^S|:x?% ?ѦSHl&83ZK ĬG;6c֗rk7dtD*f\J=M<WFG7a禞PXGY[~3jҚcr+/#٫GFIMG|jIDRr/\Ou\ΥoleC8}mp RNoB_X \ l_b"\ccҚ '̧s\6ڛoT{(ܡ Ga] +1zS|RU`̱DQb 6k fgY2$}X/ouT).s$ 0(Gx}j߶eə/8du||])G}"e w|/ul%yv˱8窩0rAr|oOŏ|?U21Q;:zXzZ:Ҝbd=;%(Qv K7sͷ\)/,e^2P9H9)n[0%st8" 4_?RɲdӐ~+3QR`d4.6_E8OO: Kg:}i)6 d\zKw*[wu TcF 4",;Acs`cVżZۚ.xl&iZ a.#us6)_NWd[ՕQ%ɟgeeXm W?fGrũPU'ypO|mi]-Mj&4=H_cK vכoMSYD<ӷa_2AZ'IՍ\Q&]m;ñvm]&&$wˎ%ZkvHxZjr󃚃Z#?/]W c/ _K+l\{I=/֖(JI" G D%iMР%CX'q @} n(`vEͦ>ʗ7#\b\-QڑP -,==pBgU~(Z0<@reMYYwF?lK,l:^rQv6kWQ$CFa=2u2x7 1*=x4:LuQhJ7g.)^OX23J)dpߢQ󁛯pHRg6)\1-#.h:׉y9cbtuඓD5oFx}YCG~C0m7EI/8azE7qb4 p{" %.zJavsvC\[fqJ Gsk ZS (SI`#*67W0B,iA-a̔3l&dhЇ|j$aMWZVną-f}'joncnR⭢(V]8QQ_GZ:5yH_kL˃F[HBE$P reibE<`͓ԯyG][Zl_Up=Ke,6O ֭u?^)`ˁui_DUkzx1}i6w0`"o`uP2nN.~"kroYOltn9Ѱ=aR:]!soџsla,/X+b݊gmf{9W*7ɲFVШsLFVc@n֎H骵+W'!\A6_K^l}ri\4U/tqI WTl;*vIƹ4܋sǷ8 4@mJvؿ~cF,Fq 4lGQAd^]][0ImyƢ[ j-Q*FZΝ#RHQ|Y&l t#VR 3q4 4_L*L5&5n@{r(mf䪭4 ^ɩ7 ܷk֝L}$ބK_q"U5MR2{+)Bs>X{RѳJ_S+%,W؀қ։(,$~Vc|&iz.yNJ1L>LI;=69KqlNBJ1u"6V?f; g1c~~yu@:#狙<>SaOрB'ZN$e8Wm*zSW$k5DU.3bؽ/7>K$Y3uۈ̇K:Kbj}Y1a4: :#p)رCƄ9ܬ|xqS撸d`ؐ\QI*lxeFtKttHp#Q_⊼JgPAl?\UW'R^hIN]N^0#؏ kUSm!4o`'L&UwW<>3tB Uˣt[j9 ׌FfK~S&/SPi3 _=C/(9ː|Bnxy}~˺S2?_dM E'Q`xK tf9H}UR;䛁ݷ)vſV才]-MbA3 1GĤV]KZ,qBjLn}?"6 gz@cJnO+<`UXB߰J_r;/d!M8}W+ćJ4}qtbuJtp׭'s9B81& +ΎlS'P:·pv# 9s'n-<)<6KQlA@9rr^rS{kW<cQ'+*)5Q(5#K%#%}wd;;'V%LXC'6M$_gh_s;,dK=ǘKSsu8)A7Iм8K:"ɡ3Ŕ_~s\edZU!=z ЛB4%f^6B7=.y=] {K܏ބ߭;9D2lnf[Y٘Y}1&]F2]Q*JiS$"|;Ebuc#b%)<^sJݎdc o*BȮ\Q1۫G]ÓG>O)jfj2Wj 6I9wPFKQTߺnPf՝~ c2w˼ɂw'YZkn<4Z<eRfBi0&ZsokK۴PZ:T}]|q?J<{@`~d ZM bZRKʞvS'yfJVhԎKټ(eVnw`3/E^JHЧ#  op,?]/7 ev0e qXué\dzEEZ[琢Qn}c6B2:܋ ^RQM!M2|H\ ymFlO/oو`.bEXc5Mhf6CϋY}-qӸv #όA""n4Ο_ư䜠إ{.> G F%x>zמD3`Q2h>~˖CMFI\aA_zT'v" B܈ 3mj]Sg=50OMSߠk?z,ߪޮ=RcOg{OomͺNb04|Dwd^] wt Lxfοd#Ik5%JrdBS,WJCB3%&瑇ЪقzuK{'={tҘr@0]bv*NgH@ (gAx7/fX&aܕ"x:[.ϴZf*]Rq̆rtỳTEEM x X.pMhPMJ` ^uv|骉@%{BX4(󬍉-qKÇ0RJ}2H{_D Yh{5*dg([u̓J/o#a<6xϱCyv{m;Fvy1o*Fm^F@{n1v) *iT!:GiXiIVh">ZlF[-^‹BÆ5FIUHWMVh~) ũeޠ1Pϴ8 ?l)m`vp/W@htԂp_Vؕ\}1F9t= Қc/_=:L8"!uJr<.ȟmݫ-r;x>4黩9蚶줽 ^^կ#1K ˹?ߓ^M\MԖew0iʀ$E㞠|"QLOcoLzIneAhl4<u1^wt\^#i:fM?JNغdSSc]MNtG}b(w [Mn{? p,hOxrs lt2ȺtͶQ4;f'zK!2_|!cĀQqΪ6"CMaǥLb 2čfJ 0`S3̼1-Xtۚir{%ob/Y&}KQVuF>F 7kZ+T5,%–~p7: }Jk)|yH+:ΦgAX^^,z?k}./Է_}I8.24ދ9Og}<)%ܑ_`2)z% Vc-Ť I)HMupZUGz.4h<>ρ`r%oH;cr6gHUG#,NQU{5EN^e@]&8hfP.B4 D{Q9]$Z(Ds,B50F*F[9|սmo#q|2%; ݫY=Qnia< |~ FnݬͼT{f/v?Ҏ^;V֣IʢKxln7>+܀a%J;^k7:isŨo$fD-hi&Ś)a|_۹PA%K+Iq,PkfQWtM "XUhrY\Μaּl2^~Y vԑ9&le&)odޣ~=ޕjYbRh1n>\%1+vZ &V} Ig2rʟQд ˜6HfA~?"Bo#yyIK*zV-URFWtkуEK`\ҧl.YO64T8d,1{3aѻ-菑<>;10tMY41֭= Z,?$F/8:z|&RxE5*QnEp̛ NAXt?m8!V¢VM;d]}y )>HK#Gv^ʗ\Lx*`z!m9{^\vDRue .ݢ:Jgpx*ooχF7qO@u|Q讌3b)j%)kl ˾ax(D/?xl\dӹ(b*ʚ=okZ1^gy͡eƎxtO!b $ A11)~*?e 'm秪xWۡ P/pur4ǚ@UZJR|6q5D]%W-^tԞɴM!0CKMaNv1yx Ij' wlMLyi_s 5l;<,A\ 9Ah2/S)(?h7> 'Xq"JWo1?oM۟Si d]?z& B{ W~g*F du- džU /ISܱ`Hk` [:m`?c@3jɺa $S>{Jp5-]PpSw[ӱ=?OH!OьtǛC0lbf7ۡUR~+m+-H-UYL+c>0(![5p5+t׀bimz:R/>3ۍ}R$'WL+QUĉiwAFõ鳠ʤ@/GOwⱺ&u,CwWLR/]AEIy}'qyJD'^fKbK(=PԬ}"% ȝ\_1.67 <5]ՠmzbl㝔F$7 L*;ŒMlUZ9껶e6Fǯ\oc>YМ{7P2~4S05ؾp0(4 ޡJrÏUa|& YpƘ[n p>ms3c껱_n:om" 3fqΚʛʩ((eޢp_e0u o޵Uc"s@Q AXՏ7/jɪ"g,R NQ+QOط&qU. <0N&xp]E1f[m՜#r*dN=`]*̖C2~C8tV >cy2(-̩ Wkߧk8No=LH'xmc.޳3/|h X<5I;zO6D 5Az@nv"M;_\/9*H@ڐR+-+ϩ]Sec>(, z0:zB1Z'N' %z, >n;jއ%b&,^~z$(`cj0SOOΓ!֕o_,oq !*7_ڡHr5\X+ֶhp7lĉ#7%{d B0 ) ubI Jor ;5jWpFol\`*6m$(cr>/+?Va"݈l3u@bE,5DiؘROOr#ML(?r/СDx: ܳ^ 2?l=O+;[ݐǎ!WL6! ϶Uqi/WuδsEWd}^;qЉ,nH2Rfc("۞ k"E$xd>} { IlL`;a,OK141NZb Ty5sZ@ջ:E)0xX3Lc 6K%}Gj-6zy|Z}QJj/IJ=T/K{9(jF2y9p#g?G{:V+uM3E>90^ 㼹F9|؁5W+]FDmcuh:A'::wwt"WU"N#ML cQ +KDa3Kx_s+v䐯>E|me.*# VbgSo;.JiIEhjU88i+rMaBbHzH4D؃B*z4ч9u^c =lGkMZ }%?ѰV==;M=üY_\mOZT=)0l ?>lDAe|G_(w3{w+U1)k] G,PCſҎY&Qhr=節_%$1kexEQ"ҩjK ԋ%)dUl̡/8nۛ{9em~5s HjyaeGtǗJev #ILӓ-;JeuO<7NTn疱0`Bg]nykT*=jz<~r;=' >7xίAA?3P. _%qj=dbKIT@bG@C$m2q/P^8H hQq&"M]3SwZ~s* b9@WN"m)n@l4vܧBvUG *mhkĂo8s@{=̂{vms`FQ215Pb`=:" }Mk͘Uހk4y8ͣz\qE#k&8 RjrVlL9Be,@+{:E[nѼu*Fy?p62Q<'YsЬĻ1G&@l߷}&50υn3RpkO9l upĮS9yT(Ǯ,mvh}Y`M9L0#ȨgM8S8HN\K頋'4l{O*ްDyPx'*H 5Cӥ/t|WI/uI5mө.V}zn[:($?u3vVὦ> 6VJ;\/#d" s:9IIQ+|ס7vJn/腧dwQ t酺r#t_1Om!#@% TƮ}f^~m%~OpH:kݖ dBЊ.Rwo;=@#?SqZE?FbxӚEb$4L<2Q$92bbI(0͛1+گT||j?';|`7ؚ?W7P?Os޹°mڹb1"^]q?2J[Ve?nQ*eC~ˏ(}Z2L1M|̽di7`=4`Yt#e}:"T V*8Wqz;o sperg6-d]NFE>O)J֨`ǤO(YEgC R׎khW!3^1_et622LX /l~棡ѻEj+m; +hr=dm2%?8S{jNuv[ 3A}#x sgɚHKv铜7/e;Cy8 r%5!Azl dF^,1eFaDHV憬Dph)U$X ꍈݐ![t;Yi&#FWs oP)=Tr#saf~ܲ8b62ao!rFMzmD^xݱK+|``?灹0~^q!; Gq2)'u=ٌ9C MQ|i@ԋucLQJfl Q]Q{]u: bƶ,ng!Ufd4򥨏v2W54(WbW $+tX)!}m 8yokh<#c: s+ )]vq,=_Nw[l;&m  {y̿gF] -FoF;N[Vk<;ؙ[N@aΪr6_!̫5G`;Fq-^t0(_Gnfjt T!ݮt@1VكǮB~ /Y_A4FwкZ\e?d2s\&?71ZSG5FY.FNyn3A9䯣%so"2XLg| 6tg=J''< vae70d19]TjњlY<4x kEK2XaqiʤR+]`;d"mtf2†# ?+g"gY拖VE8Imcb|G"WnIs(yokއΧ^Zl1CW%2BQU;R^Dj/Jv7Gpt5&˜Xe`80\8hEKz gf/|dN3"28ȸY<2գNnJFocd]XMx"Ө] i-|Ω>&O6Ϲ   9ߡsܩAOF0UV(Co2P))#7TP%<.E'J "Tzq{{oz6Y3~a!…++V%*Ow.n;lXMIVVBHIE9~ΌrA5\ݤE^<1>2ՅV;u%>B%-0 C"&{ţ攧0bhUUif)Y"^+_[a &|C HfĄCYiY܂A.c DFz<`>y Px[֔KacǺT 6JtW sWtIkÎʓQ;P$IP(5t@VawiQ2ޞzm}8e;W ӆ㑶swT A5j?uᛁBTd|+# )<5.P;NF~kL]Y2u63w"gVZjNdŃ܇?{%wDm,g]NKbGYøH[[76ɫ.'2pzYɏ\Es-elFpU51K^!o;`MU &h @;fH9x9I\W˨dV``.R8S?!AC=<~Idl9棍b-WSiS &S+ ŎP1:sjT"EL&>G㕽fjUToB5d 0O1bI}Ůt&qiEzVjGdWB.u`9ĸA}lvqVf7vs?х@K!u z&^ U6㝻{Z1d,ik.'/=`Hdq}į®".pcS%N&Gc I4ўP.+2GrkrϜ,Z}Gq4 tH59uZĬsLha@5 rBNʑ(  N2E"$&`Tfo ˤa<.˕UPXm| z#D?'20;i) *UpSGO!s0(Ql.+J8ջ;kk1$YbI$1)i1 _FIѪ3funr(64r2N%>$$w7 * <e zmHh~!DO|.weހlrl8˚QzSl!BGD"[„ANAAHᄁ3,N`;>s'Tii&Ufh>1e]؏ryY5^{M{>Yk?܋d[h1W^C])8Lo#܄P? ͋ gy|M1\-J^IY`n[C|*K9i|D}Y:i5GSLs4 dXy.J:94ӁSm җW$d?1e:3)HwjMZa׀KriP9Q,ԇKIrؤ^_պ\U;"+V5|':ѷ(A V0CŢeC}f Gڃf7;DM[$qƞ/x9F5hR]* m}}pjk@TzAt)U\ ]$@"ߤ &q´ł瓾5\NbۙX'{I ACҞLyZXMIɌy@mWsv?_ rP<1z,ٌRNO(LTƱ#k _f(6dȅSZu;Z=^78YWpIѨz=!`soL+yG\ta++޷ v|,t!YaRZj]^Gˑ%EY2!0V[S:Zn,}s\__|b n41uJ) =W;o=1 e!'M1C\-z:*I%3`0!iR-6}P8B+OX6l~t/K8Gj}vUda]B<dG>Y[ta>?$IL(6@Ly_8hN<`.JpO32.=S[Nn@·{DEW; Cjl7Z.%^ak1ڇT/Iք@f`%h{m4Vś9ѭ󳷈 F5 ⿅|<6QsY/PNdqVwpGuWB*$#DQNn\ZQz0om " 8R…alJ6zޤS6BL[8H{r \C+(PuKqi:"өݔM܅l7%Z(>2\Ll|1_]HЉta+g;mſr0ő;Vq«U>4{5JٸTǀK4*eG=)\I7[NӖ%j!ka|v;\.Vju<]:Yb s0/dyNU+?Bh^tWvݙ~iH^Cé"rI2b U5$\:k~\k,5_hx}&_%-)݊rzai $vSwx~5VѰ]wԃ]`J r藾#h/+ &eؖFwA CcêՀ-3 دj%IL^]J\&7zK?$F$ܬ)>ڏ|;(]=OsV2{qboq,Wm4Iq)>k`xys+_&<׶pWOo~6Zz1ת%X$OaF)qA1_?+/8U-ty1ag%kXoZa^\F\iݮ,Fy xH(| G]4X߃I#:J}h-zeM\Fܞu| J oo 585,VG&V'.@Yn+<л9_/.a(_|!ط{.W "$ 2-=cͪ2w䘦]L UVg+ z~ػt n D5MD |b:_gth{$VL$Oy?dC4x;{U"$4SJD ݶjTG"xi&j˻҈9B{+[ʺ(/ \+P#&j.PJYyeT+I%]QC__H{#$K2ވeuM/wveқGӈ i%ޛq 병4}.#hM6R\B>A36&kJFGvzTIKgB'4ZekT3(܏< (N$X,8vb,5cرin;`4S0Q_ϬJ_ pr""nP ,[p!I B7vur˙D.[j(~yjM. q|;,jY Wh$; 9+(MEJn.CT?\M𣧰 u2IsρrsNL?8JشU,|ʚ*g#y+ i*A.?/7izOb~АavPS@r/>ޔlGv",HJ#ȋ =W^lM1 j,z9,Hg淼TxwK ypLEHse_a+=SA7-$p342z瑝`=eW'^o[d?;Q[$ͽ5]=R@Bؾ3r4Fϫn2DŽ.1aHf99̒Lo&!ľGK!"{+xK7NDJ$L!5-UȟqnV<.8C/`LGn]4# |ܗ裟6@>1Hu%"! K!}>MmWHr-Bmw?^J1AWg56'4+!}0 $N)d #騇E&1)ɮ{j 耊de y{1"%bŮ.!7@L8N|0Y5\GkM'm{EV̉C1VE*F".bX.sR@GZ9'պ&L nwMC̸5QT"R"b5ً& ظ(/ [׾G~R WjKRVcwIׄMjb添68K?P /-n9,NX>Bў\C_I?H7Ҁ nUyMܘ <{^Hjp~'>)QsM=[7"(LmHiL-ʷv (jAu^tobeƝ&(|dgtZ>Ku9NH5}PZ麲%7)%6D_~ 8QCB'iA, 4<*A8as.#hO21EhmQ5} \c?d=8I.yh.~ WGxIw3p:ަt^u::ʍ\PIP#vDxk?6BUs\6JDͶDvĀCTgu7Gט04a5ɭVT?5_DQ*-"4,|H9,wJrv"Y\ѯ;k:E~\\z݊_'obzP'_D!^LZ36?ȖkQQ_Arf C_f:}IZC{$}ꐧO~/;iq(QMfЮHYO&#+#&ve>6^ĽThɪ^|}#6Aa1_D7I ;?B(gXDX[Q~zYYq &g4Wj%\=|oOZ<ؤKIL$f5DpﱋN˷mPFA]`j# }]7׊bjY(yaSpjU9%4WMt̋b bQXh#'̝H١};֝NO;Dk@٫sx[ ?^hԗ)\u湥u Zul3܌侓klO(Ik@WBkD_4d-a {މ?ZΖv\Vukik\lۖ 9u4o67݇ʇD}d#OP\$U)XPH9BX^}{U3>|Wުk@D@k/s04}="5[X*i|)Hơ s^<;a<6YsH-s޿?֠W{6y2CGR"X`mȵ]*~MHzK:½&|wڛ![jxc1T OR/(F\z$[x ȉra4٬\fq7 |D 8莓 ,M}@-'r :$xD^XH?gT/EA@ޑ қRD HEԀtJS@Z(ґ*]Mvo>>gs~p8YYko" ]*OGrHsM8[}Lԍ! !~HpMկ5*G8oi(Hq//?t FhDlSyAȳEf`s,ۋ"f4߼]f J_-uh XW(7QU}M;;*AX`? <qNUDfڿ;~6"/oF[&Y)ĻD{J=K='}|;ج,eN%ްI]7oQJF̥:sOmw s)Ka%6esc`j:]]g?}]tcF22If)6o1%<,x<88NQBtyjR_uf3>"*!f|lB=>}4at%V-b|K}JM*g-[K T$axIZ<#[@T]?>\E~ITYmDי;|:(YlBd'\);mNQ(?~`[OK ,TR6J4-K+xĝ1F͇U%PJ+TvТςX߳d0 7Md>>lC5,_=\Hp ,w^ML/;Mp( *`I߻-)qK>*ݡjʴ<{_lg$TcHЕc)1#Tۑ^J(:?σ3j^fS˳i#I)jO PO䅍UІ gKNk)v",6\|ӓ>M1io=Pj&X ls\5fZ&!}Dk@7A(n +!,^/ v6ʓiN*ߖ'^} s:Q4ֆ-o W6y:2x[ O%&ʃ,/r#4HZ,_瞺^4.X;Y1dJlI|Id^*6 Q߿(׭GH(Up.'?*;^|-C˶GA %J_D1yCR_eE؂{Cl1=_QI}TB‹ܞ-{)K>G`PM2rvfj:SRG.⾖Z]4pqk$:x(~D?ĎWUc kORN{ISXcƣT<%;Ȕ2O}ֶ WvRޏ 0t VX7`6Edž:k!S6Zᡥ6'E߱ 3pi#A۱Tđ䞗 f]LގKк`쭑栧K7Yhڞyx`R=@.VvRP+w45~|MZ!M"ya቏ړuiQ1>sj'0u[I/Ci|J;!4ef9x~tm*q񼺀 17cd?)cӯh5y/V{ ҅?K &DUq  ÷=(Mwx:zY'ÿR9{/u{S+ߡxRn"-)+d\RПu#,3ގIߪ?W㷲MI{b[_\IEѡ %y~F PC=WvQ]S(3Wh Ȝ׺+ayKo?g{\TbZXP['E njfK|2 Q3hJ"`W_qS-';hJBx^3SHl(` )96x/ԍ9x%Gf͈'H_`ىZ[R}F*| hCa )"`tEA%7/+b؉mj&֦ݝ l"Vg0Nkf I!JL8a2;ZR]䍃?VTm*|2xͣ%\ٞb_qϲ|:$;q1A4AA]mrj}.1WiL  ?1ڹ! BL.I:kv{K l֟v5Gngt11&2\&Y&"{\1kp鯺 gJ*O{!gCG\@4F?(Pן'&Qk˦mwAEwTObM#{:%z\`XV\22S6ɐ(?]rCJ8ke0 Px\2VQbr|wf+jQn+&-P; :VЮ't \#la.U|h_k,r%/=V>2;k5w ʬN (Fx+N2njhnWA&Rs3Yyyi<S_ >^KF1r9I?d:1栆5?:Gvh^Ν841y./:yw?R&_ v&vyЦ tmo;rB4]!Wu!U|!uqfjCn9{ɨ>ښ!d;ClCyvxٴ~43|s8_,/~Ef>uqĞA7*8 aL‘u>ꮲc\_ƹQC j~4S<7^͕✸KcaX/W^j"?Ui@@şzKnɷB_ эnl e̔0E%W~븧y?ZnMY#|v}<hIқ yM|Dؤ|Y4%DڒMtA@  XHn>yk;k}$u.`365wJ/,!6I|Wg 9tnUW-U. !.T89;T=gi";3OOtmnm&WaLD6VK*m'8"LY/r?L୏c}L"Dau׉VاMr&kS68,St,yK9 !'?ZJ%:IMcpcZ%mIqºzn_v Y8Tn6@ozuk僳(xdJyg5&R$?rضfa?`&re#ђ$;џ/" L%MNy\9 mEyMTc9y zM@^f)3~!X{qK̿qLF-_`=J6q6cMLr/VaC'̻'?|0o`ƧIOUt^K\Jyى!.!I:O%&džEl(EJ{VmҭzcjC vt7zDgU׾w&2}m.?J+F'r^dxebnGVM_g[U^n,I$טgiGtf9x h vōBf.sJB`3K]|kЄ5c>`N@rs.a{&YSǝ7GxÃ^>+I0Xʨ5^/TtP+|mRIP;K I23+\f+⌳֍2=FۗW )6˨ζJchsATr{XsQqm=TUBvܼ,(0e `eeb-];+mCgukF9gCԳr"YnK|Had-˂kagΟ=`nqwPG{sth`9%Ⳉ >M] <$r>p)YNMoq+[9%y522k!Oԛ b}ek/P@W95y*;|3^"95Ɂ%`F@Ny<8?B -}%Sћ.6ISb53`IĀmҳ.)@B{8spdLF_ i'4Glʵ"C\0kllݓ-ȷ@`Y1oAub?y&t:+QY{ P +l6V/ r(e1%V\RNp{, anbE^ڻ t6m|Gꚞ(-⌑dC{nx4ȉlϛ2|3>lg;3$J#v-hٟTHsdc櫣|7]߉gǟ>#+6x/乂/y@?ygϛߋ1tזBio,*,HIJsui,t| "5G2ɀ 4QLnF:G;N~u%J"v5Q\.W@=ǂXN^QS̗dp [؇!Egq;~q;dX!L+Zᖐ^+dfCn7Y{y-b`XfrCT翂|y I 'y[r9^lQ}tFuQ6N ,YuC0.^ܯ:ht(x8ZW{S;GP]lnvG˥ Zb |Pn|FP{FQ& $'YfL;_a`>Q8KWӊO3lER?b2Y[MFRb$T7\&c<[a%%n>֮,5KI̶"< FKQzuyݮj 6e-v *Q/HٚoDt@܍\Ri&T&it\P4~tWOG'v%L1Ega@c8qh7,.._b1_{}Fl9 lJ9b`6O@^ڛHs@aUdCf[Qَ+O?_/ U2WފN#R%XI~EL$9kQՌoQ̱LQwthkFT(n%X졹<]<;ffdg{(e"**r; 0q?XE+W]F"'Q q~z+dӦbgx}5=]XLhЪS2tLo.-i|7J ;A J(F_8IG kJW }(*᣶$F`" #b H | ۏ4y>`%Ԟ[9TTzΔzA/D$qɱ*[v.0G-H3[~ߠ, [+~ 8<| ,I|_]]Fhjȟa!PrTV8OK_8>ӏk:6`z~"67sN2:ދ Fs:a]p,@*㾃@ϛs'Dzw!z<ѻֳvs, JW,>S~P 3![co.=d{Ih7s?~ ǔO&퐎QqW]NZ{_E&/]VM|=TW|ko Ǔ|BMu̹폫.%Q^~RrmU _@/Hh\UX ѯk׽o!S:Tç yzI2Mx.Q*K{#b&qLYr|:f 9d)(~ǟX @@uijdcTb]`ogMKT"H;XH[Kp/uuJ^65cɍd^rO7m$wtU$WmiV+3 #wF"-2S(\Fj0ƭ7\/y|)}Ad9m+{eD>1ν-p)SM嶤hv'Tdu^wZF?in=}…MHur^ZDTE^އ>y!Qb?eGb`CLR^6dyuUjIsA#5ɜ7[e44nZ . fy qO4Vdjќ鏝t@tH¢ ׀Q?ѐ+9k3FRg.YF6"ޝocsYݘ􏖝iG'εZQ&Cg~NWmtש*7 Y"䷜Kk$ ݱIȥT@vGǫb?ph@rڋtTFj&#i'/[y=ݘōssʽoLh2M ҵ7jCq=dt>X`f֠G=}~?'\'Kr1w e_ʉ! |åw+pCX8Д'Rv{oa[S(ڧݼpPe=Q|x0`' q6b'1iD gr'w^}o-Ѝ*JP{M=z,ѳ:긟jJY^/~o)Ӳo`kQR(\:5OF U\^b@$nt+XLWRA^6+ yK30ԫ=WbHShgk¿PXDXk  H O&TtTѥ$@ǕCR'Jʋ޽l]_Eۅ%}߭ 2Ѧ~Ғ쫞nnQs9nM2#]WwnIT{Wϫ*:湺R"w  aIy?˹"G9uT]C` j漪C/ʮ'bLZתJo||2qtUT6D5u] OÖcg(@ tjUfY]L/{<9k8n@t7 +ҠUZ-ȌH>Y񨽟 oiu]}Eo*eFlaM>ܤ zܱU돵Оv=62;1OoC6^vIxHy Ձ+\/#+mˋ.7(m%tO^?b˄]>8yTW5)]Sߕ8{F6}Glj}1׷DZ{mLڒ޲lLUQ&Tj|VrȞgc5¢'n\AsIY-O+#2r}xI&?Bw'qcY,ߖKcMoaInDDZ"oaB**? /2\i$\΢PѰ> ztvVI22ۅLCLD3W*I1E-6-Ƭ/znsv&W=#^4;Jgk|Xhs`=\]nš"xBO%êyVt'agu/i`ܝ- uh p>;A#ܐ2Hse+ 0^#{K~~Joz/=ZYyEbg@ݴ]i *dfY+ܼGQ9_vL F{9;kJ'[/n2 J_^{ 'Oڃ牥P<o_# mµ$/1%aSYYN,9~)"~Yr6"Na]NiZtw=Waz1%n^ *DZ9R"hX|*,!ɼ'_LRU=oY;J[Kcf|VQ$+7T)XZLk|C,՛b>MÆ Y%"|?m{|,va.Os.ECW{S sQM4~Wde?xm~^idi9?J[:8zdCE60Ŭ U.qlt011 Yf *t@.gr v:hU5-]cOFCE =r2Y>^JODR<8WR7\$ջ?n/ճ)rjr!1𞣛 xxkwHR a\U5 /Sp:Ϯ\}{uh -[n۳Sb2g%zQ: W"+EHv/>~YC`}ws^p&NC2cЮJԫHp܁{C.50'ǂsZw5 ,)vY/O!M7N/-¿@.xřmԙW6Yy*8'I0~lBGodH'YKW`m "y W\Gg? diraŐv6d>@"];RHnWl,^^µ;;aDGEVicٱBѮ0*XlKfB\Su-lgtۇSθT7F}ۖ tW&![Hm6zҡ#g]Eq$/QV+bF\M#S, >X:Bf{\}媠?v[O{M[E>/]֥'obCd^Zl9IyP {1 i3M{@'8u|PօǙ]qxPGpMݯ .}R86Gf Z8{ *5$ ڨcS7@tnF "7m'p[P,$ ȗ@pofQװ/eU)V,88_~FS 4 ފ@|S`sC5\Vܧ tI͕9\gg P"N`DŜ[UxGO`Y'y`>>Y/%aӊ|AbecR V SXzl2ZeukR/z$^~6vѸLJnC*ѬW?x bFVL'wS4 T=y`hn`w^$;i2W ) r G\2%ŕD\j:-tGK*pd^z0Ǎ7y ȸqv6ٯ-IX׃z#48ƪ?^zNdxIb ozz\u֏н0'?G撚eAKR] wڳ#;]Drܝ>eߑʃ,cUS"Kbgq_KkDPI0beV6L߂PB M$|C!º|4ItPV@:Q ی=>2/a 6,Y_1wd{.{ v_W]pn<{~UŞqyZZw\!wVTO=-Riˮ渌]d f?_={a[>轹.Y)ٜ:a#Ui :1Y>|Ni50( Be9}ds꧌r'Ցs:o]te%$:kْk4xh]0hur7sU]6 WME}ɢ_=IF6Lϼ GY .݂8Trq =>qK\D$2 LsjE3g[rԱLe^˽wibӍjt_2wb oh aQ$_%r3{{ǭw8ak*Oc';4#]< -M>9q`j2B5ɫkP [G)H]_,>k7ύ|:!+GyxtH|.ʖkOpл/WqFx  ּ[*ژLeEoJ껕lI09{6#' EkVt{ 65 n5mKJ;a1(]/'hHS~e0Yf~L0Nf<,J;lCq4ʥH(mQ$* 7t pK) -ɩ 2 ɤ@&[~6їm IJelA@*M|XORl^6F{Hrd FE+y3UKv!l$Lxwx -<9#řPLHܡ'hgגZlu{ȎZ0# IJ< ÝX*3LXa- PFP3ݝ9:⯼@\JWT.\/XPo5 6ǂwqA ]{*ُsŇ^b*D4lW}ߠ˔H@NAѮ9 v>y.Z pBv[K0v `&l:%ݐWxGOJ_m(-&pH(8'nʿ4S |_qi(oarTOK⾲_:|M+MNfR¤M{ u+u{ 0(G=ga@,zFN3ɒF?]ip~`\U28A9Z/Eu[p.m)E>zň|=bR{"rܭ7Ce%Q֫^h=&EĊR8460w` lYmb|+9׎;к!Kݢʹ&2ȿͳ-:hNE髉8_͋i0ȖDf`0. !/ܒ[c&ǹԁ(MGZ7ڷ+4e؊TT>[^؆TP7eN:G+fh[/4JEi `:׿2)^&|\ r{ͨɳМ  Lk'j]>"g[a:lP:ZS[}/(9,17HA%51  '~h !98^hfl#ԟRW2Oo62mWp#Js[^gvL|} ۖU"dzTLx(1}r Ixxmf9.rUF!k!=ɠA2D1ZòZmia\a}^(xjc#Ksh_Q2{է\GTZ5#AFU7U<|qV۰ 2UݵjyC %9JUPځgI)Ov_6RxirKc^ѹcu4aACe0Oh[(T#O!baD86D ;"kv_~[ͺsz+'Ѯ/2}6u".>fOt@) iAzq/@k/ݍnFWf _r}렪kpazA:l[w=\B?NPͥ=1r̈́-3:J|zY.ЫB&qGM3|>"TQDzѴȷaenJ6#l!hEQ>ٸ ΣF LB_YB=5k2%ʵ6aoet3ۗPfTL]Se܍0^U~bAOE ڑR5~?9k~miگ' MȲZ[Zs_ įW5M~@ݸaAFn&s拿y Z +'q312=lD5'NsyR=TcoG.;'$M#C߮kp??--ׂ .vB45%Vph];{ȄUד6\2hVkkw/TV4[i'럾JR:sj xxKB.O0lYU_( K :Xj ?"znJ7f -EC&{K"KDv_(а0G|Z@DXt[m#lvB,"A N Uq &#PQ I05摣x>~"ZЎALU ̺}մE.Z ~L8~r/JyA [ߝY~>"8?(Fvb1Q?mhSTc$>6\b DKQ}ҨБX%\I7UO1ײtLJ$87cnwWaRb|i"XCC8_1rɗee (e ec^JC<ٺsw9^6K<:X|~N]ze`4&7̫Ap uYW8v:(-*m*mEuDW5o/ rurh:ȷ3v!0#ʅb I}0 #TW՝Q5N+, _l%WFS|= B̂';tl>|F+xYzϮ^S 6&M!|75?|f s6{wW֮Ȯ ,_k9l@*2+Ҏ:(RBG-譵z;-]GU:tY~Ms| {{s+ QmDu;$ vחH)ۈިʕ;ڮv]"ʺrc˞(50_vYh΢w> |X_;[8Tbtf6Cg[\o8 0U?dwQN%fG=D31f6\vO*!TPC|؟ʡߍf&&'ҤqbmWV[MLK\~ݗdíEG$t7nZ=9Oh01dJU>k4Yd޵~ự(Je=RQ{O1M,j[!yPP)Hן!7/-)1{ CJ4lA,F6L s_8/|w?( Z:O*7l#ITm8AhGx,B)yͼ[GcN]Q_sCeU*kH)]mk`gOڪzVJ_mGi,u𴉫/cLF.W%W5'eslBkyy&˚N>('}v|4nux=4/X&i>|D? НoXr.сuV\y)nD9i]?՞B_%݃Q&j/:An8!rG:HsЭ^ u{&o_XĔdyE ߷s&H6cQmotZ˒5+O_ XQ۶zUgvLc]!Kedzc-Nj{BUb="L+oZzi\GuXF rQ;1{Jh.{˗)[0a!Q 1#'|Mƞ$y'`SBqRR5i'tpYU><Ҧ/%eFj g]oR7 4qkʙ ({7)qfq1 oj4)l LaJj~ǡ*4~6{t@U=|R\oO.C`L]l9$@b-NnN@>,NDմK?XAN蜮j aOv Zl!:Z0$,.&+l΢|@FgN|o*5.e0d{Ye a. k>WLi_?ҹZ-C(+bF* tr9Z3oZpunh}N-c|X ;NG4oOpa4EetFsQN빐)Ooȷjz*h%vxBBUw;aX>42 {0/r;KQ0Ь-`c6usU &z'ㄪx˫F3lQ۳mb(n"o^ЊK+a91+ԯG0| 8C`u51Nqxj0|Ra"{0PhQzpi vh%hfX~C>+(;.r\@^[YnO-vG<̵%G[$eJ7:aJjRݩ)-DAf,Ճo|v̢ 3:eƢZo~Q9C2$ 25AlQjh=م8mAMݺ1Nmh>°wOXC̵ ׻U> A@|_/?Kۣ, ' |7YIeKE(o=zKDEW('NkqօLbr_䴮 EdX;36$A}KĎ糳i$ }? *!4dw{lVǫb6{ WNHrł&D`As_j2 :b3YC΁naI"EXr-!T)t3) ^̞3 (X,Ck@5asXkX+H57Y WD9g 6vh^;Q`emoצcrL:e>CӢ5fz-A%l8$):bt;8+{z>t?S@S0dA=4r]fw H$seNru$6Lq-#`jP,-p /ReM2f|Eݝlhϕ\f0t@ qq>ct+|'Y-InM4 E(crUlخ&A[dRuSZh/uh!#3ҷi2,*nk-݂wެĜgd )V;R,@Z |3J*\T[g/2emt<->)(Hw3YT Zn/B)Z2ix^(K٫B|KB-C8I6`I|O_+1^ću5ɬ{γ0|p6Q~u,0:@T7u>% =|fCY#g WK, m~0,!]uwkA͵B#dZO82q/Jcxuz(If_fjӒ>,C;9Qq7> N\j>PKB&AqO.OEBPS/Images/TitlePage.jpg <0~h$bELXfljWP)BȾ$B`Hh}~\\us羱?7r< @ \\2%B. 6WwGSȮ_ڪpVQ]EH'Ȯ~7#%Ⰱ'~F(*(k(C%tTt:4yUUUC~}{\G.߯rA U..z!\?hd[?'eYFV`~^,+V\Rp*5EEoZnu.oO!!a«EE9aѯM}"pp{@ٯ 0K^r& 7h-<|+VϷ[P ,\ͳ} auRTDo<1ޱަ]M=tLt "Pc3;c#af&Pkd\d}SWܹZAD)f9ޱc)5EZdlȗ yRb3g؀,Յ%q5շiAgT6tI"T=؜Rbpz_l N@ þ.]nyUS(4"5{BnGRC,ҙ@(je 3.W/5Ԥ-;DdZ^1)x i) 0˼XVJ ,+ tL'9F:j7kiUwlϜoUT10|]*QI1?3P~иր _փkݚwB3S;b-uֈ?"FKe {w~?.Dq#9C6f 2ő(,!_J}7jmWO鮿h-t'1XF(= Tl+DҢF'X8™$'h̉?vV QZRűdB}XM2+W=#i-ӧޝX!l6 Il\H'dJؿ[i:oh,4>-5|cDJvfSpsgӭ{CeMtͼ^4ݚ+=1e;-a&S!IhwF/н'`j a/CөBvW?|\~k7FćI\!=6R~ *%d] $}dl`mqlv8[."ֽ㿚u0\)dܬG8f}Vx=g#Xo ̩ha¬"R7;1>9hg -rh '_Ӻ-vF5*j-td.MO 3ꝐKb@Y++\Fne˼G=рK_U`E!^y=H&%kZTEh.4[ W}pO O[6/d_c&^BGEߌ6XIc 5JӮ7w؀Rnz*H"X_uUJ}jOAv3.mv"VbC~qو\&&#{Jd+5Ld*NL#5$qkisM1mVv\qX:7O` 7ΜMEaI!KYTW275 "zM-Z&.jչAn0&)y.]$\D<, 3.\ »2rb5(1xIl_RVDP*=j$W <~D,lcifuҹK2˝׏>w81Ggy֏Ь;3]8(<脪ټve02hWR`*$My}nRޭ"!!H!KƢy63\JffcdjO'fJY`l)K!sDIG"j.v<8V|$׉>Vd]jI TϙJ<*a ,Pfgk8cПFn}a9Q-{<3>*ݮSPh-v[< ~jU9w1%FLea؀i#%%~ 5/*R];ڍ"_!.lJ 79:5-m @XLGnM.cr ׼s;J'8y#3 ]2wE[P@+;MdO[-`&Ha`c|VG_>4gsgTkeO{ţJdLĪ&FtYJK/GS{Ymμ=5Ek%5ٻs{J-gأu ઙoնQl•mӻٞ8ß[e4>#+K-־8@tăp*<ջ3+'U:Cգc&/ԅ?x}%; $SϤ^jrN5%Ndsu<ǢjݥayP?zC(c(lAmMhyJ~ 8ISR il䗧2dw1}Ӟ3gDŽ"uޱLӿU>"z܋(UO4-|^؂Vy껌ZDFF|QZmJs'%>Q[LQ=4J4YuUOyT ab"i#T\Gw-Okġl`03%}|^nL ^̈́, 0xCb'۳@deșueL6;b0 cֺ)AJ$4Ϟo8߆1ena^^I)S/lP:GGi=ZEznSMlNs<}1"-( !+RDklUjܽX56}_yNJ== =1LcetҞ g- ͪˁ%-. 'FJtD칈k![Fc#jXHVzxD"uq^6 FDзo=E6Wu*й5DG^EV?;wD#iM2AJa6@:T-s[f-[-fHV H hoXg ~=|ryE鎩}_B{%AK| 6HjFY뤵Kq뼟^s4Q%G!]c*R!@Ӣd[u4O; ,l*}S Uw*TMyRELgPrmfܚAJ(T:XZ ɜTh^[Q-6H`y,Fb9>U: s1g.&xz{yS;w$ŷD;sQo\`dY7i8}gԛkLI(+SH)j9T;ZU%Τ:|o~hxo=ljX;~KN9MqgT֠vf&ޱ+, 5u}j!և@>;΄tj(K.K"l5ê[w$y*T侵r@N1F4y#S'a-T&zR6=qI=f\D6C}rK-c5ǣp۱jGl=\܂ҏ5:"6NJ/랼;q_ ~ց?0~+4eީqpܩܕiezS-5@u)$R, Mf[R,UCF_Sa")9{&6)@G[o槹z"T#/j>dkgù;Eͤ9=sYGU7[ uٗ܉;p^ h[KMUINFKᓈnrxƞs{x Uk#6w)[[(Ir47,2;=1UԌD0%vRz-YӮգG?8L~JHiϐ(g\uy?AxTD"-ĮdrI 64[؀# yn/F$"p{gA gO z/Dy;muEs6UQwOkR\mt;KN>dbƳ Gj6e2Eʆw*YAC _UFO aF"/hfGB_8x؀dKKž8y >e;Rel=QtzfClUWj9H +jV۟iVcXy2O<hV!RM,iiM@#e *Wd̔hdvl(j,D'N= {jGoԢc 5ڙl*)* {9N8Eud}N{72N,ftEwlNģ?p+cd0%Q}D'OT>Q}D'_.?ݾdXD'@!?ƺPC0l-Xvj8&PэWE+)(*+{a~n$NIM$QzRVV~F!HېvL_roN0ĹI}1:zRu@V\ѓECFB, UQTQS#,-Ixx~ I}@ (^J* ` [&P;cd "|+ɻc8=)"~[]}\(S#ď~e=JH_$uU~F3 ځ3 %d @=Jo742M!P p;,7gF?=)Gh  vʚ:PU50 תVx~ ڟ*c=P'cCs8i~ fmljllln`fe5'؛گxs#CXO/Xhcf(inbUцBTU$=: TCz- `ec Ĺa8zR F1PPTPjijikC4Mcx|oUhhkkhpjC PCumM -m+hVc I??_tvx$gw|~n^ _T@jebW[-LAnU7TWPQUPR620PRQT70j(kjC5klb`eidleKK*{s??O[%gysC7-o'jXO-irgu[пYYEXDK`YZPe# p` ɪf[ 7D_E[?$OKR)eEg}w~wK?wH Z;p?dcmj~da( k51&Q'IwT gekj$gL (?$) Kk~8!V#> ¾yM݇sq| M+gWx@c<@óڃ Ax+@| IVG@έ(!'8"6^^8d;FXoIBIhkkIG|!pP<$h?7I*rZ/_o aWhA6]=CТ~@__٠EBX_SIowJr@pN %j'2 3$@+CaxA0 7%}k0{DFQ{Y'pKK ?J3%rW8@ ƀ$lb^` m4 PTM@5`\p@NupHi@ ρJm>c40!?D"CT!Z} rr@0eH4.$ )TB@ ~ dKKKk'% ?WYk\r=*jrs+pkqq[s;q{rpGp_~ȝ]]=νdzGGGg?=ǟ' ]'<oP+| ||/q?'7_X!Bb N+0+N]bEWʬYicɕQ+,]ٸJ5dW魲[Ԫ۫V^սjV@@@J@[Jj 4<&&*BSpVHHh>!'!54*^uŠDxBfI"2"""!""y""W޹hKVwYFe+k׼Y3ε&k=֞]j:u!֝YhuEDeEEE/f^vzחa 6nh߰Q|FƋ66om۴orӥMٛ6-mlgE{lٽ–-!.umں{Э[Rŷ߶a۾mnn6"NB_%qS$1*^@W+[ߎ`t)Y){RR=ҫ=oJ!jG؎]2+edNvth&Ys ]B`w=*'%# ~7n'vn璇ʣރpOBBB'v(9)PQb)k(*?R&UP9REu*B5^UMHTV6.TOTNJ#R fAG4wh׼١%uHV66QT3룛;Wv/rzRznz%m>/eߐSICeCQ cnc3KL֚؛5522060 5{w;i,-m-Z~<@R+.+ 21ksC;|pA0upty;C(;.{Kci4GchǾ#JGru؉)ʼnl|1c珵ȺqZw<~fЍn~}aCy1CF#<<=bFNNĞGf{'y|}R}ؾZv6'wޯ_te@J $%' S]s !/xM0&O< E v*? A$=%Qx?ZuTiѧ8)=+~e>p#R72ԅw.޹Ⱥqe˱WW^Uz*wQШ|1on<^=cSxS楛sĪ&ŭ>pΎ;0o}o뽋h  ͉ē.'-GAÝc9h_yqGۏاOgc$҆Uu<7F??f}SG?̰\<:>z;.-l^xX4D'0rR%fd?O\?rȯ%0-UurׯJTٯ `X qqYɽ h>ߔ9^n~.7J}pX|NjY^ó}-  0 S7=nQfƣwTfzuI/M=IkF#,S[2GՒ.q70/;ǻh:Mm=(P{:xۏAg4;-]>rr2I=+Hӏ`nuMv8[5>d].9rlۗ]{Ld#țq 1S>[v[\W,o&_ޅxWO@/WtoN(.+b5iYid1NlEIl'[oZfk&5I`+wD^ 3 .xbi8Xlf97|:9WH9"J魃w:] A 6f_8tZAP4LRbm>"t4VП(979#4=W2Qt\G[Ak:'n14Yu0I(l2^ĨcN uvfh=tyLqVExjfՉ^::TO*dE%+ۦbJȶ+gM.]Bx~x*$j.10i$QyIegfhC[TA Pc]+-B7GMaf Ҍm2"z]-pFظ+A+>B.uPi;kSi3qOj9[Bdɛ6r>jw 8ʡ4aYH n}ށ oֱ <[juwq9̻Hڶ9줅gҒ?Mx)HxGi{96h!QL V?X}=/S+}a|C-YUl&aIfo~ CJԶPt Slq#cjI)*iiU5҈9u=Gu5 DZ5RR _4T^~^YEtO Ȟ }_1scK3mг@B {'(-4bbӈU҇3OaQhkYi3''Z^'Abe_^23ij[N.fi+0 X)-La6ZKXY lOTV>9gJ ֱl(*qŚE}+ LTiKd qڳ¾:~kI@z荃7[8.rFmZ6(Cj 3/W ;NN]--r5v,%$U('gj¾h\]L`kw(UcǮOT_pn! \'Xf-xtfBbOz[abv.M¹TvUԀLj39ckeSqV~5"L}RcTOhEĉl١v<56A<\4ـT9sdk{ֵ(8[<Yd j75p[xrhE)6'N*ZB^;ѽрɬۛ6I)uki07PD^u=~58ỈbA\dt.SjYl?( ?l euQ7L0Gr )*LCD/(qdrUSZhR gvHV5f" āOenʘد!N-61.1>͍~A5czE)ʞ~K +{&My>sޢWBCG! 4G0ރZsz (Z0UvoW8n*-@H'jql|'iϛb Աaw_.|~23[Ҝ`ٗM->c<]hIF]so;l ,:7  qjBcfɥl"sWЍL"br˳$\ XR'<@w2Bfm dJLцKrA|M-IdnMp qܜUX˟(EZahKU=w4S-5fsB/_Ś:@+##}5^9ֶPa+p5czMĆЕ7G̓&(4y؟\WB\W(XS Y#Y5pL\6XVKݰhkOF1~{ 3E­I77ba5ٱmw) /K3oT.p G) u{\(o¼8G;pΒiDwwY)|i)VqF:S_hxwƥU|ƻfyQo_gkO7O'>E`m7q-ǹ9^ Qd{[^ 1rBҶyqj>/nu}\>GvuX ȝ՘}GҔQg!C©1yƙ0f3ᤸ'-No;L-dZ[ sbVMZ_]?<)#Z\q$ Dq<4DL<]zr[ɫDnqI'D8MḪDѯKu#2-l@eǺ?BuIW6) %4>{o`{ 9/60hj[%;l4N*pkIM&KE>IM,"]C+j=XF8lcdX >Z3i+0(cMRQYi| 7ąbXEin0KO?30 FʉgdžD,zv T@mbW3B,fJ 5ex{(1FXY5Y(wKiΓah`R ZDy=R'^axdF,L’*}TDUrAW|S:Y/El.R]dC<*8՗A)VAp0K-zn2ՙ!,M{=.;Ob {B37v>(Q C*`se!a\8)4>*Ԩ+r.E:d%E_M+O|\Ydo"~"?C`2;w>յ?ӊx ";PgK%)`Tm UK01 ]d,4?׽ ѭN(^ȗt ,+a,{rpFl6}'5>1G{G-$K/j/%'+=R]^Y=87)_6i`qM\뒠KwM jŗگDŽPy6 6V[` .1,rv]Er+ UhH]P=ЬcW&YRЁJ|È.[u-Axف1VLN=R1'k vxga)s6Ҝq$f6 t8@]fK&l+'QDH,0>{$2]z.ʈ`ᴝ>!.,f9NcIe@I_3"-,~ήf+\>0YRLM=N?.>zKtc&_PB/?/:9XX&!5ǒ212~{!70jZ8HƐ ZiS8 <.*YC4qk)A-u]L{AS# m)c=al8L t#8ļ óNC/㙋`8!1W63Xp TY"gMx؉Z%8RfvHIrXr>E|_Yxz&Ynl,wgFg^:b 8mSf0x))6KDhy[|Rh.ӕ.i茧nS"hi~~UW]$6t **@@_+?Dv1 "ƅg QQ/ßċ̤6T.gЬn>t;x#"ՕvIx8:+88HPNo~co.~I,ew'hhmJEʫb ~(˜Z8 ;+ESs&?bEne#6Pk|#.#hV3zJk{D=[MFJ`EdQ}$5c4md ~fٙ’B[Uz\&Lt-Ȁ2|?󫐕Eg@^nL.CQhj-nggVEH먊 eN/õYZ,!2ٲƲ¨c̴%LCzMiOvn(Z@ԝqM_~XM:`a1*߻=?!RwN thLuAR,! R6Edָ/|M? n:ܩ/S9Ta0u !{sc(-ctBlbNrvd[߈BM{Aq՘echQbJ ;V]8{J?YnΣY9kҶ160G^l%^a^LP]<,14?̝b5`4R)Do62~Uz8i괙s"+RCeO@ :x,JOKNbWJ[b͔`΋GZ?11e0>d(8zed,? YS@^*0TAJXϨdη+1l]< :-7nPxś3sv-! Ӫ(Cfjf5$>gܬRPf}ؤkG=#(t%T7oi X=ړfU4J#^8AP d̲i5s[ n<7[:wI烠[껎#7& ,Ћڝ  }.x=r0I_rJx]#%*?Ćˠ2`3Dq$5I|#ݗ ?M3`+’:O+*2&CT$[LۦB,.oYs%uɤBׂKxz(zU@{,0I*]tcVԓ1gC$rt5;-<[ZYـeZ"ZKz:"iѱoЬD~Ol Wn}T=~t+ѵ*hM], 3r*:vvT Tq,y&˰@ӋU;6s:L>졄j$׻k=BUVVM[FЧ[΂Ke7ZgȗÔ*;Jr Ͱ'ejO #>YtSdCLBDhfaMgFdA7`AE &d3ބE.畈x/+Ba&>^s٧kD7g y5AbW f}H`p6PRai7)\7>-MyA,/7,e4fz1eQ-ILW @0P]ޛF5뢩RdW٠"*KJP",K)ENDt IVDEE!= !"M@:$D !];8g{}ww?5=Ϝ|C,]4`ۻx to6KR9%i-t-Jq|\TNgnY ;l4U ~SzQmQA ?>缭G>5lgnt8>toׄG] ]X3j]A'(,Z.K蟄5/B^=Sd0>`b\ &V?1@6 AT ;znwf)Qxwanja{^RoxbQ ktx{qz"&^kT>Sa,9TzL^8@Gx~Y jaO=PoV(W\ c.֍YDW㓝/6gΗ"O;c~c2ɉ_4_nek忳S~^(."@O/ey.`]黥IO^3#~`g_~!,kF6/ gO朮F>a|1}oJ}: (d>zç̿5-R;!oTZayF)bLɅ|+fk0MA]pI$^ntv<:S]!Z. [%7SJ`ҴL/$_ Rq@nPcB>Fn5oϺOSchVt1Z_ Q6U ۷Q|=Ñ ;^O#x}AfjRCґOX}ZtSngQ;qRF1}USL|F};*f\π]TptE0^Vç{=N:ûR)7 vF$~-spl^8 k?ĩV+π4)07\ ;x[vnX.YPZBZ*\ DA¤4W>!k"ӓ zFXynH({1״,(^*JūmVqQ)hYBʡ\XT4.0}TUb'X նad~ &FD&ƅY_4>nIТIU,^—FUz=jnٮR-,Tzب̛K/i"5yJ<%bΦ}X/o gg XDѓ>st7#V51/yt<6cdc;j䞓C ̲ƌO2>Q7hai7}WCA  ]]Gz'S&l$W`p,ʿ![LV"d,Z~V d0UlR3=?b-|0¾";ƓѦSSJ/3(HuPXz;KlӁM?4bYc>avn邏lkpS1An{CZX.haZXE [>ia=*CI]!m@~3 Q$7žZXߞQKHmA@EKڣ"R'zRqg=-K>.f>plLXl=E"tma|bMk{qWˎ؝_.r@yu>3G}wlwb䎏}QP\MtO 5 B94tα;5o ߍ_UoB/NP1{Ix#0~9 sہB7TieX۹4% %5ne@N|γUY';O:qec{ 6bz_*/@8Tod1,hޡOUv%bcМk03ɭk[;|{~fYa]:΢Ri^hW|t;uO_1S+կ~\w[η̇VTDP}^s-iݾ&k{ĥ/z~-.Y[9'+ unj퓼n+o_Yȳnfm"+.ږY6Lfɪ{lk'WdA?6t':1J(@NBڪ̒+xm.r_Bvu#?mkC7í\a/Zظ]DJP,ҫh$.M'gT?$R:q)H͍\BN|䁪k[ Rm:}u6)`x3@@|cJsFeE΍1c؃>] zeWAÛ7_붧£qk')5KfnmN4 QT~c ia7 MJءre}6#[A5/s6?~۞yuUK//ыxK1&(Sb- FDd/SJ8 R.vJ>M6YrP5d,z$2$=7SjdkB\{2I¾v#U Ў d"+䴎4b'dgne\Â-%,f4!_s5]}EP"";R 0k`R>eJ^M)JoUe^صÙO>/4OZqߣ83ªWK$}~$h9/͎N)5ϐ:RO0EzGb"9|˾*;t7U UlOrVN)|Ó{]io?]+ 9~ו4/ ~2P`cd)x>bUD6FvlC[\? SC%땛J 1+0R{I;@__^<\g l(EicrQhz >Tz ʽsxJ[ނ kQ'"Ϛv_5NbJް}|V[!`_O7C R:qVͷNs*  4 77B9rdgRduh)R[IQTfb& M2o|њrSW DDBPAO$ua6 sT{:2$Ll P9w6(@^'$Hف.{CN(["2خ0W\IZ*y-,o\qv|yf71Csk0y6))pjMTko1$zFF>}O-jGFYs1  ?rb 2#DHB*A@I!K27zL j]>8KT9[33EMKR> ]VƊ=}tm.B6ϖ-~s-eUf%d4k[ִ~>S<-Q rd L֠ҡF_jX}*= G~ W{ L ǿ ezӦ V%趋>Q-z4#ޣ"r]662K} t()RH1+~XVL9A 1WHK KNrN`5BD3*߮v#Kuz-,+PFUvϥe!tH: 2 >ďC_q,a2ɷdV O)~uw3u{W@)ջfќ =/_>./(?B._J|ǒ,iyOJd 33}ЛJ;lO[#)Lt>uQ NoP4iyUŮTBB^:ԤWvb@}vtbawl{#8agHk.c"^QaՕ83RB·CRﭲI{8[{p 3Lp791_iMn+A\R (Ⱦzoh܁Q05+?]k8;YןʜQ6gAʮpWJ _聰-Lç g>#qrFm7+33'<]|jn T&%=SwkmÄ3әZҴ%6fQtm,gE0iMXLJ pB$ am;V6免:]p._jjNzhImTTcVCH|=Kѝ6~xbd8!kF=0`szݙ3+q{}OHysI9WT`Hv;UÔn^_W2{KjKgE$;p؏\Zx}Un@dv$R& 򟑤pO1% ]YMluS2,~*~ "&6ť`mGNg4M7oDGЬy)Rfɭʭt($ojwu6wu!+~Cha_+G$`ug6vڻ)u>VSf@ltiO8}晍4v^{C'_7-;aoQGBQ]A'eKhQ:E6H*s"$. ;+aU6c8??i>hNj0NUzQ[09'1۸*T1ʨRjɫk.5B)O[qi؍pلYG ɘo>{lx?G`>Kjs-ǎ&TBq([Gm4\$<:ݺH9t<`NQ;V sVg oj8^kkAcV}b߁mx+߶89;|#'b_5dÚ{m 3S̴;P"'rQ_^]NZK^~6OKck%(-$^D$^o/'tq=<ToO:+tSY]jE/k)Y Gz\x0tc_-](]%jaHƦ9m{ң/b_;1܎̣LD"5kB_jˇ>+7,ڤZ<jCwi=vٮWwex/ AYrEF3kH%6zSM"CTu{^򱈅xG2^ފ,o{w_+r럙 /;NVxy߲>|PFc)lIl񴜪c.-_//prӐ K#F MOCmqtm &ɐ~#eWJ A?f*ߩ"InnLW\(I-oCG}uKYOy HZJ>B뒱±Ѻtﻏ?L(IiR ӺBqI8-B&_/]ޮےf~ρ\BaxC}|9Gѫ˱ɮ%|cG @3,Ѝڗ{v/#< ,Z} z$P ~I ibHג]T^Dn[nn1;[p}p4_vX&}廝ow:)oD}Jsuxdރ+sXQ,o8E G.i6#iR {?(`/:n)bG͕dM~fܘc*m+UuK%zǎVEٹT#|;ɑ!rϽM]27޺X^B]a'4-_7sn3Gİ95ZguT. &ӢSܶ:%Ƌt žL]6ԾN>tKWbDME!8dž}ޢ}Fcw|] /~.!eJ66(79/MSI:$  ڃAim ʩP3N?{݄Ľey{䪺Kcض̔{“LJ/e<}Z6j~VK5hW*hn|KlypL5=op]a>y09/kؾG*/NޑY},}CRl8RwŹo^p!8 auHT[`?}|{0WxF#  BHc/yc;h32QM L&oؓ+"j3GK^$*NL *PS(V0khukT"˪lOk.X,"rxG_ ȳ05B68aD&\jy>36 Q^D:𒢠M"+s M_z@?-sP&-9CcW`L,}!ær M} ݼov+-}s5uQS611jv2'^mjڍzmE*gIJli*ur4ފ]=Tإ)hά5[k @|8^k`(`t؜YI׬5˱GkM~(!&ÜzZBaw*&qν^quwɴ .AyV҇?|9} C`Lkj:0k_5>qa'GlE{75a+yEy Bd8ϣ{ C`c¦/@_F/`;+00 ,(R~8+r;3 \X^ #(Ok1Bo`X^:9!0i5vL?`3a.dn?wJ G-L_nZJ]'R_:]DߔW҃%߬E0ΆJ¿pv9FlRQrN RQUm@,W k#-htx7dp J9Wfk*Gwk.>\"N.B B1K5 L < lͷKKy]`<6j]bXR?kaױ۝JՃgo]k[1#{) 3KU(Yr)ys2'Sto#˝6bz0Yc|,(b("uO +L|~|X#Qx8r K K?g!̿N L,l|5'4>CXҋ9paXYu.zQ&|yag#>O5a ;RaW0#q[Ad 8n4_CZ fǁ~lUx0~sug3k-ܷâMe0m:rٔFi8W^]j%NA"D CRviay5qRz vyF(?V* e*rzol'p=+wIԻB $ gSD- EF$ P4lMT6CQpH}DEDZǑ9paY3["$5 <FiRo2{-ۖtR]O:gJ׶d9`9BeU~q3vK`55|/>o?j-/„>66mxyhH<\|V3Po00O}#8zj_$"(Ol>p7[l? B.7ڐ %* hms\1S%5JJ~]9>zWUî!lRwVa?]t΃#$d W3kCMD;<|3P+jr/ Mjl |z;PP;tn "QippjWw!ɣcznx= aA0Jz(Χ84E+6p'}t~ 9T޶Z=՗6Yè#~- Xtc>ZM,JcXljvLgnunOՅn]ːYnzE颅ȜN@.:,*2׋K=Q~]ĺDke F+do9nJ_<^G7AiیĤcg܌cJF q 0-vJ"[Yg8!|Юt91ISlFqXn[׽mA/Z&˹Z dD J: k*d ՛:mm H[#~LB’.M~ƲaIg74#s3q6[Pma]hE֡6Zi:_wr2=ĊO(4%Π+0 ')a Ϝ1R73k(å*Ʉ# h%KUb! ,}oҧ(c^B+z'A~Zi1^pJb֯#ݵx/C D~ʲ'8)+Q$|tT;%PK5˜FM5;$шG6%N[ ۭuNJ5˶g([ -Az8,*qdk$OD˷FY#>r-L7u2(ِ%BTqa&ژlUYOI=<ń+ ٙ=^m؂LmHM! \-Wº^g0wFi6K,*.ɤ"oOב;LpVQPX|ƀhxNJNq_y"¶F g4XSrQOtx%R NĈjfI޷ޢm?U/&I -5x~ q8fH EM\muvyӈ9slQ"ƋI Vr(#c>|޻w~{M IJCJhbaȨ#7yjdbPvpbQ+෈c5h)ReTl)K^cqu_mYwpm5ja Np 74wg2oJw)+%(fǒ&+ T a99JviEd vit4"t)A6H pdkQ^7jvvX rR#*r7z!N?(PԨ_&jBz9DņϘQ$ THDџOyx/3 $P%VJ򴸡5٩96Ur㶔A5)14wxua(>i\>DHU^qgQKBw¦DVmT4U5F%`O}nn[;nj3-lׂ3R( EĤ ] {Q; 09H!b5m>_;o`t=( y400@S17M_-A6z)$@ #UUy68PDy"Hn&qubDXbAպ_w`dۯEz\E [6rv}HT`I☤ Մl:4|ƿj%1PQ0sܪK{o h)-N[h¡kp)^@Cq XpIY=o֚,콟nۧC(>CYxQs7Nߠ{[ʛd_dJ E3Ko݁ñA7A} ZȣcFO(m/1v.duiWK |[&V\5"%1  vo*cҺu_|]3,Y-JG$*Y^R)zxg*ϱS}ͩ|7/:|i>wƢ>P:&N#Q='َ.OԒPL]:fU"ȓbޑlЦFɟ*ӽ/R{Vg'QOr.=p3cH6 `[&JΏϹ^Y/ <E+OW&N<01^J#_ C+:YZǏCpw{>u}hEZݲ˹yzAh)3>ɠ.!>ba>FWbq X;d+iAN~>lݩ="s媗E ;]WKfR Lc ]$u0X,bb'XY0RRG}Wdd\@a8NF3% i鵴 ׯkm"jwa² Q9u$oU ǭEVO`[$`s, 4*Ki9=LO`e+ZԄVd{;~$}w:t̘^SzWaޜ_iҔd⋆'eS+@ "d趠!K{t-"Fj&r@* ]JdXZjū8PϛfI썅py[c|"yY ZY%=2/>GeU׃'bRG֫+wuRhr5ilc0iLR AٗH:̻?Yؙ&F-Qs#j9♹DB&wK#D.hmٓUGreLIʸק_QĤۨ;Y<'qweTz 2K, iZ ez.LvT2}L1l[Nof51u2\å{V9{Zc;qj6F.~/W9|ͺl`ouKzO_ ؑͭ&];dR2"1reE5$E"D_qC9^ӵnsȾRJTR6G ZbKy։xaGVjXqgB|/EY։]l_'`k/~ץ_n2;z\ :#x#>x7=]kBS48#BZr!QivK{UʃotA}݇/qB/0&6YqѰ:V|̍>qڃ[||wlK= L>uS!v>Z;DYӺOզIҤP{[@8s n=z:G{5e!qىRl&X5ULLQfT5&7U^<iY\K$#k 듍ʎ$W3҆Y-;OGEtQyLEspN&m6(Jl_ܯzo?PG`6G%I!n?nִt zV_5Z6Luh7:=LߞxE|%w[1ii8:TCs-ןN)ާ|5-dGOe2H_G^׽;n؅Jp9|NT.[k )>2{t"炕GF gikNi0PT!F_7 `9ܴo5FhJ cD8ѰktW:ѣu#yN 40ǞS~~7=cפ~ M|lظON1px"x@-33VE'}Ta~YǙ٠}_\sE=ߙNX OCWB3;f ?gL@,U UM pHSmZSJ=ջD%LߩYpI^_".zJMJ^3yFE.7EUڄfTBk"VA#hS]o4] 3z|gHL[gcET7$=_ְ7P!N2F.o AzkcZ%3IdI M%3A/}P-s=OZ'j(v>LEgߵ!{"S5||<X]a{@qYCLܱZpZvU>i3&DGg~TgH p(QQ8zk7ܣ,|N#m]"nܝ5'??/hmǍ ge(vi1r\? 7惶'-7 嬬6%8"o07e/Ecr?92}cAUwnrwPT8] 8/Z&?׫gy%:\,O;O?;LR t0G,ޱ9ʣi<(R\ZWĉvqْo &Xf$cQXI|JI~.y/_)j%fpVUޔ={RB`u,V%eK۵! @1CaUagYP;󊵥7U;c&]wE1-O"-P `Øk<]%j˳կ:Q@;%"l)l1Qe\=pOB6,~xρ uԦ;]2_1vܺ/A2__@5{ŒPp=3.g"rؕ2}븴[ZgBِԻ}Y t<"61KsFCCeYG-jZ:'NwvoXãB5&9ܙ>VBwD'Ӣ$/ J/Yklc>k{ߋ9RvnJf^f`=+Wڣ@/OsF bI X'2y= }N$SHڄ^s$Գ˳*hGH3PVH7dm[-1v|蒃iCjzh'lsްQ:Vӏ4Pᑟ!ũ096"LK#lhġ7RZ,h'Xɡeu4Mn1]H½ԈMh3cu(/N0FYMKp! _{ýAU 5-ճ@B-ǂZBLoG.(i|V-3Y*ܵ[)$/oCJ3&/y~~#W<>Bx MWg01e‡>>Ͽ@f]aZO,!6'P݉3B1rPI^IBz$V%M/@gEx BUA7|&y6uWLT%\ǐZIןnc/!+̴M.+ fmrbi$WOҜA 9%\iN5tLvJxu6`so2RǺr隟|%֬c:5i)~Eۢ RKЯ Z4m=vK"Z~08Lq֝1eq]@rJ )j'Y/Q>o6JƭxIM+[ݼaW\^VBLI؎d6'{vWD:X`zZ%k=ќc;[ov!Qn#ՇضFC*9ՔXET47CY(|"fQȥA}ݣ+̰Zaoj?:8\?y( K=mX#l% lnA.VWވRs}mS ¼(OŨ_JMzmL[q?ąVѣ_nQw\ #}"!]9*yUiu&`5vt瀬OhQR^i8K_\s)&?@E #c.NN.f 5ӆT@YloC$EHue1~gr3i8[q<[vh}!i.3k~) |kuÌ_Uu&t_':p #z3dHqy,ܵ?b'h,TFE^}5u"-spGYd> Ak}yJmH[7o<5qt,ڙc4WAHĽ߿1]_>R|!eׂIFr^i]=3֌{4;TdRc?%aӈӑT !&LF.؆``@ӭƞnTH8pnuZuC͕Gj=50ᱎe?ϸj\Buv7R,HæVR7:`ѶrWD q&tZr˛q.2[D &A\ X ~vm(q3O(j0f).T3"cS%towd`w=" S>B2Vd5L\ZF}( ŕ2ⶒ戲kZ]իA[(|ʯ~:(nb6-{$XQQhJǍI W}]Ѡ>#bƴ* $.%Гdj2gzs2y~=<A6S6LNR^VN'S}^hRlhIA :h3|Z8_p"ҢTJ2iֈ/~*Z}RH?HwAѦNq׉Aۛ VC9p[ed` ڒsӨ if)-d@;%+U#kt+?G9\ BNň蟒iv­{5NNdFWx(\ mdgذ,a.ӝ p,dX4 aVo4aض0oEXJ[ٝ4)~P~<_~_IF-J,odq@_GOnqzGVRKO-]dI#**sfy2WO˭Jp+Ppir62Fad?]e2ĈH 5jova@ -LǕQ]ŝO+O0ᤰ6Z'1LW?^{?])2:'ur4#}k~1xZd A%1 ѾH>9wmV̜3xkKX|\/@xh)EI>lk^ԥ牷:^$_n} I4ܯdL) j54.-wFAofS=4Pb~'b%(hڨtQ|8i_"*c:-c<_%gi~I$j3r<US#^~z7~?d<+AG4}4ȿ_1"|XB(~(ZѣiH>H'ވwYK`cJ)!fKɖYy@!,A'$s[yOQ _%^Zqz.~J֨&dV?-+2Ɵq)~++_ Pw>+?iqtJf)O7~J^v:n4Ʉ`Z2DG/FmG:DO~D@e*p0퍔3’N'i`#M)r;ןZ)vg[WS+ M-!̴f=H :oY.voөW/aUB߶]SO\Dtȧv8?@&0C*-~+{}vEA~aCq0*0s )X ]nIlF;{> Bu& ]J^2Z潩I98C<ā }Mn_T6e /AóCq1tIk(Aiu} I)9s{V-K%/KЁ")\ǚV1W @ڴ\&]ym#gGҚ :vꝹۖ-vueuviR{_>BFd؉ȍ%g0*[E[]?,0.t /Nk(bШK1*@!DY(AȯX_ZY;5SzW[as%@YPT#MŇB[lS➔-+FJ5>>]"5- La|[EZK62)ZL-G eZ"fx!Q[Ef*ew ˏ]mEfsJq _/`y>֗;j U:s3JHUcnݶJˇeF44G bQNidyogsEN`"glF8z]'݄ߥ&ȌёSC=z*~qk~ƕr.5ElTj߭">ym]qH;8/&;+*+۴lVNʸ!'xLըl 4({[\wWrmGsGԿ\3}>KuA}؞s HLj $4K<_YKK ١߯P%r_ZE,bj^d+D9S~Do|Kn'M,|Zɷ;&*hx6=<2ڠ 6XZOT5&d3-;Nj;ّ4DZ{z+I4>zҦǪjvZFsC?hlr|;MU7ؗ" C -%op]Fӣ(x~" dIչTZ6 BIb5k l}VGZpPI8S?ƨEL=F1o4}LΏ-[ #"&SV}:0VM.t'qs~}n:ȝ^ɮSٳHF^/XwJYyTj.OmhY hQ]y1WCh2b۾x\x5V:0k1OVlXo˜ XwI'ʑ op?-o#( r@Gm,plHvԞ]zs0b"hv1pdkP^ƾ am ų9.aBY_mhǶEҪ3ssõLT0Z.vRE2Ue/?Yp12~_7LyPyWx 74x%xax܏'2@׾\>__+S03S-qP-YOz}/7<N1Rkh^ yFԳ[3Lmc56UrHckD?A*ƶq@nmm멟lHHdnꛄ||ELx6vm`0{C lCĚ7b9Oo={4'$ʍqW7͂KQ#d1xsp[V[*ëMԼʮT'_8`fx.btbPY?\O>b8X^9_]/Rs'Yd9Zvl56YNL˹ P[juzdNj=*%rjCh4U;G7l~ tŏ5 &4JrYz0%Z%hjZz*k/Te깡QHċW-ճC<)}kah3p%Ѵ&3mqA3r9N Y^JD]ipV%+!K,/}61<<qkL6g*ҩ[n6XYe} BT Ʈ1&*4sT͊%abh3,+8#31?& NlԞTwo=+}zKM%#[plg<-4Jz~MߣHDY̎XH1zÒ4셓8`rZ}rf)gc<iMUkAȦ_ro)gdiY&HvYxඈz㇕Eov8e'"rVjmtQiIF|󜷑O-Z_('ԪZ 8>ՠrޱJЁ<c~ʏ4e Ϗxk] ~J<5 Ue*'4̬u.\.;?3&ҋ˯S6trm=_{*?!~N MUO^n7`_<0_]I-ek_CLcAujqYM|)7]}݅&G:nYIGSCɂ:VF\¥‘@,ɋP"t"<ދf$fIA#HT_srC\]gȄoGy`տo&K,oV9y/yĀj˱u1&ꔮG gQϧ`x@K'.NN*6֬6Ѓ 3 FrI>Ŗc9{&5HD8&cWNvdY_f^4m -Dg[[jŁ`ɜP&E .;BܛPDd 1o瀛B*9nºMԁ wZuFӢFo 2jRY8$i0oHB?uLIH'yrT-kׂLc^IQbnU6gڰk  Qj f5#c? XGx%ۻ"Ir nտYшF{k96za_ZUZqGvme5{9=rSMA'O) `٢; k4f/5}qHRM[!c\ux\ٸt& ZB7 p^)ѮWiͷ@gߝg0c{ƫ,ϊ)J݅#7gR3vVgԺ6]]a_Z{X,6["3m<}jBV6q/_%[b$D6KwB}Mg)YNAg' q_b~!N9  'zD̪"Xf(U8J}Ee]諂]֜`u-e5؊8enʞ8;<@L^@K%EcП=|P_k 5[U ԾꍩDRW)ڍ ߉Lհ:w/[=pґI͙gbȡdiID8.L2hw:ZDP^!m(`K6w'<+G 9Ѹ!Dl]CyI Lt =y/pp}YnX!er1'}.R*$_&աdf|/%ʻUXnwBtho̷ٚ{Ď 95@Iv;p} ȷ~(rܨ] QRYtTߟ'5d= (RS}cFn.}}It/mh<:s񕩯–R)Bjo"]RGZ'nf ~ʷ=.[J+^x?N"vn+[F3Z_Y0ciEРKf*-ĎM@#X0A(JC.AI\`E7EHݗhxaڡ)0eq`ɘ~}ځ[˳Ef <~W{+#0U l&=\g3Nڟ,g*iΜa+3~j X A{|Z FyJo6S%W#iΖ $0_|Kv@I&w%y80{WWSpҹS^)EHQ4 U<Bm` J*AO7,bH*@|ʂ=xIYE5״P5Z\KF&.}H3֑%<7ϥG뭳QQ& n _]}zdf466~f?UAI zr3l'* !f*{)8+m*3'i"9[t-ԶƄ㙇#|O4LGsH"-*,Sqz'q=V,-^Ze(T^|^A|@_ h^H()Y5((*M0T~gB}"r*!&l+vI,@X4+>Xω`խƁU}snFB -/T\WV0]2SiHTcHxLs{n K g=Ol4j<@9F/_+g'P[#8+RZ4׾yGlWn]V 2q?^79CԖ55 *JC&Ϝj2r (pb7x焩1vcE&2{z'¡Ohl9=zWHîGCZ0"#(Rk<>h_7|뎤? -s\ڢWX[ r\ iTS6:T)R"*Bʲ;!eQH*N RJQQPQQ'H"&!@h4@4$6m~|~{ff:Yk{5 ieMyS{˽#M-ׯ7yTwɁS4滕W)>m7Өդe_|˺'͊VlEVh.ZLƺ:_R}:=劒7cן:yr'A\^aR$E#"EG_\8$T.;<|tUt)dsFMN+0gө<a\!3!]ы1CNz6 WQJ]Ƒ^QObP+h0'<̃~ǖO~éWhVq;H{ tjd]\XF΍ 'e{$]7ꕏ6N)O|:}u"a-j<$(߃4~-H]H|4Vyʫ>?\ &a?g=ePФ7ohtFjH:5W&gpEM8L'wtLL,)99rs?st;.iw=!?l/u[>bSƫ Se+^gddݍ:3zp3=_OQf$_<^zF%U^>&lWoaner9}Z֓| <]zD|RѠt|8z!56Tbťi@|8(yqrI,68}I;G>LNƁ7NKM_OP!#lV3M7w!ςK 7~5 Ujuz xJ-αW![S5R`M/X;?|zV̌gA/\7=PT50AiYk מ;+A3"]Ӷ jYC-)zIk2&U5_Ƽ䄐RMe Kz#i/fq0y)^ }j I~K@J(Q#],zS9{JTy~XW LP:]XufCWp':ѣɲ^E[ɶDz}Ce塷6hbu&&.umՏI^(]5@1 LI 89VɝIT6BM@m>lUò__ZLkq=^bpJbT/3xq'ձf3AŁAp50L)L@C=%P {TM{.觜/W-Ͷۮ8,j5"f>x=mgax||^ajWoզ x 2T*ZA67?&\o$>O"X -Ȱpsr5y@G|}kڏ +Z7Zݒ3)MS&+P\LJS܏9yLe[.ͿZ?ܿb/6'[)G@4,,B/=bMlLwϲڶ1bEkWkijh#]Glm\/@|9fobCwsa>^}s;L|n-UVux+je^/r3YeRZ6ibhn>}M1ef 55NTC|-Pi; 4R5˖n5 )"h%I(8ɾa0ADy+uNM|} .ᒽĆ~:UePG󞶆Qm[ǺӪ=~@c@QOX(5j3 tʭS7ۮ^F*LN :me˹h#f#jkXy,k:.jxɺk|)=C˧!Z3Aw5+]d(co;A? U@QneH6^3>j@эԝ`6>^Ζ2?p|)"onC[͔H8Usc,j@ɩv޶4xt ,CI b7a,Z,ׄ @}.=*T8zdA;9m}GeU&mF+I-lM|Wס9ΟTMհqy|톷.ʑ ZnxoOV&n'h߲q{߯sR&`)L oV7PސI|U+Ь= 9ḃ/U$ڎP4`}삢sF%T n\"O`6U (j/Q#xpRcSP֥ FF4 $Z'\`'wG f{0i`k\wNj"vAp )kհ4ChY=!꼆D/ucZ"N0HsFoꨵti2optJ\^' drqd!ɫ*7Nv ._&8;aX^s6tpnza?^?(WpEb aZ4U2:0ُ.䅪΂ >B;>l^ۮҊ Q AՁ T'؞:bEG67J`5eJ`]=eq놊ɡI@6j^I_vflidyy[iezZl{\ ЫFa`Pb-Nh^JX¨qh?m} =yVEjWc3(E9ŐQ*%j2C*le='m`Ţ?DUYOgqj <T#=A $UU^z^/p_hw4Ri%;l "(X9%WqoqUeK˛n-5 E 鷱i ţ`Z6homM Zz&dꖁsP}dUՃ^ ߣTz@f\jڨӒ'a"ke 2 hzSUJtnA +/Hu]<nJ]Տs,\a Ed#z4n E8#5lHď\J,q?M/)3Ɨ5KoJ:UW OK(3GVgVcx[]9ߺN+J9 gzA Y4!L79FiHH|XU/zUK:*P Y;OoYawxt;m=['D]pMEJ#wDB=g'g@bmbt RQRXPן(EKn\aS8QQɜ6)-l-̭R 26Ȍhz.̎z`Y)#;ʻqo!q(.a=>i@VٳDBsjY/s4g?w D=Nw@k<ʯbb @)/OcdsYDa"LeFM[ZՆGG -!~01[H68_jYp2r{!}g+s~:AE7C͔25 .)4z=4&Hi_1JQ8ĩrV%?mn nVww3jOϮA=.hO J5BL\cϣ'fQ1yfI|Tm \ ]+fSїO,x9!ZJĔgd쁌GP&\X-U2ޮw65G<T\>oj< ja@|fn >oAH !y 㞲<,.fsz3*]^"!;Er6r˺-OjeIC)PX*6 !cYtj3 kk"}5amg.QGPJAU*$yLFDM;gN~ފG+=/^V%߬`!cM v!j\\Z3JbJaQxamGbV!rq(0MZۧ3X'<|Е{)fHw|tGFiRB*J8X@ B!S6pvը;!u;}gɦǡP̟4jMp!'y!ȑGh+n]o#jڅ;gtF8c ;\st԰P ۆh s9 0*BUo)QnvM^WTqQAUIkjw'Wr kcXki_H΁)+L9e+(61 5왞lkK؈ppyAWl:/Tl"̷vuigrOȾ0A?1Z:߂bvRm#L&qb oFMJ-lzxk] $C/iۦ#SftӢjr$R]SqZ>ʘYDǖQɰ} V{6=Z)S"㈸G|4w)9Pu_Lzc,t3~,S Ix+KdP51x0g,!Z~"fiQaͅWpF9*gnZ&5NjYV~-s~g3_k۵RFRq%0O،]c?=JhVC3[f;+DSk6W^+ʘ-RGGX4 E6g'@4i`X~aQTCl.0?>xJm%̏Z B| jX\k5ށdž)8RT/-¦LST&ܴw0@x>iӛ\]r Ֆ:{dWjz BOk1[2Fj> ,RذU(f -vZmV5et ^uW8.)E"Oπ4tSZYHs*-`"2o{`$1Al rDHܗGغk:{pBj- ]_7Y?֨:+r=ga~+-)O6oڇG3Rs}2^9MT{? ʣ`?O}b-ʢs"0q ~+2g 5ewh|?a㴉IREyL|0CP5SJw Ы٥XɘvŪArӜ ||D5=1ʡC$4bĚu%\dOul ~D@Q(pw.GI#uϮVE,MYL#0ΫE`e|sN<٘V$6NsR>R9) S}g }UO[+:8v\""匳L\ ]J`_xSKyf] 76'cQVO NOX5c*zYYLz*Tb5+njGæJ"U:SV9-=6X/uI'TT9Xc)0N7't fp<ө'z.U8<)ewHڠ/) ԟ!)Ǣz(. xىy:BM躀ͭ(z=;M+xӴLKi'Ξxzu̼ګ.r"׌j`X6i8BѠN53*@F`ψE'9 =Q.29vaѧHރϹDƗל(E&kNxY'9ɶW1x|옼ÃޱaE&,pKC,3JW!m0!;g4+V5gaV8Czg%aZDl|-tX`vG3ZI1f)3T䂛հHx&esuL4.Luv!8nL]#*3X)5 ieMzkMlVi (TmvmPyRxr ^GT C+evv/gqMR%[ ۆ~yQ??\J' W|V!&LeI3/sk|ۗH-1r/TujR+yƴbKb< s]5ƩMnOٚ;;LOyK^5S,*] [⥑N_+^ lQQg#vވ|wy3G80w""#,iǜ9r3:ˏwD5kM;4c k&RJVgFLULs6=.h(hdɮp3wr+]o8ߝ4YxIq#bWX/zE)z+$ [fD}oa2o#C 7o)Y33(IcqŦ)jrE>s5o9E]psX=#L[e0BF( o9Qz_ =oS?85:J5m^԰%p]拵:,=*+N sƥz3S5l04Y&(']jn5;i◶ =Vjv|7}z:@|fRh'{k/'Yfs0GV:y.(_C\"M6]Jo<)[f\ntP\D~eg:`bl-ls7'+՞ V/3d/(զԵͩ_rZ8Ή"ܚORhnHꃟ 2˜hs19n jh;( * 3/1Fn_Xd*NTa [wv{`σKL psT)N`!I4Ox-wf_}\Y?Z-\9rr6{=&ØȯMlÄWҩxIڗZ FmOݡȫѹHv$^!YX"A:7.Qu:Ʋo  T[r_}T]:;?:7qƍG0Lr1)b}ndηoRrӬ+Zpȹ.5]N_!4>@E@RV2l)-,k˥~`;/n ۑ|UՊ( gV\koa.Vʫ5ӯohM urWshH= TPJ*Htn(RzyìhXG5:׈(?3R!eQXF(Ee5 'SiU!k&8_ ^D KacDԕ5񜔨%#{])cWG:2n _aua3ʶor>sR;abl02~@0a-*K2Ƣ"|PPZx1A{cIf'^ms@s&e6Hys oa3o@a[eJn1]WnHn\kD4ٞ/v]iЋMaD$<@~i^AHKd=!rX, K!KTi{lJEHDFN*boeO=*{%{S? 7j꺖I].CG>㲆@rqfrO7H3?o{AJ(B{fK3C2p|?/';E;wQ̰ٽSa'*vzhDTJѺ6e3.}s^?nNJ:[Tຂmé/^Il;'ϋρ+mWi2Iu}) 5/| s'd!aa@M+f.m9v MW&U ]QjGٶ M7l(0.kAX6['3i2Mckf[-* /Ӿ'gAje}y@jB#ښ%:/vϲ w- "jGrdwքsS֌"b*Jt ;?Uz&S[:H1}z Qؓ']+nz@ʑZ 8,ZcoaGPp0NG<^A-iRM'Y!WL9zz:fKXd?Q UKgOp-d}Շ^&ɶw ׄ!6~塓iֈb< z=jv~{D;bdZԚVeز;du{u<ʆDS ZJ)3\i%nCXv|@ Ӯ;ggdO5 \cKB!fvTNzN[ݱѯ{l;ذ>IYMζQ Өz ADU>r,Ē=nf3̻ Ko XH j 9R|{ZGDcjZ ;BȚf^/b&c&ORQwQQ*[i=Bu?wY-݇겢ʛwI_KzƮ?x͑C|{;tF qH]5,(7/qBJ++|x)FGIe(܇{\~*MF~^FiQE('C/|y\xIn;`#F,5a.k\H ;2fE:m0ek4om\V;o}@RڽI`saOa4Qv5윞_b% \Г"L[ZG qE~=ڏ@3_^xl`.L֕v *\e{G=,>+Wc,k928yh>u})b$U'a͸KaVqu"!)~9Ic>?qWE^bsZMVWiڳ - _b!m'oS eSK7)g)rYݬCɤp͍Fmi1Ξt꬏=sP&Q"gsM|X6b|VD z\qU%E(svzٕSSNOWכ+Q ;%1c[I~0O)-bz6wq\˶ Q6q&;t|ntyVd<}f3N<+yWBQGl nW+X 8.tg=9zF_E[h{]]N@6Vsd-Wx YdPMV>O{[q^s7Δ_<6=)|bBĜrYAe?#]SL˵`lf3G9n*Tvք՝v5l⮘2c52)3Y2%H,!zLQ8 ls06Asn`mb|5a:*JՊmB2pxQRn^լwgb]`R/=<x}ΕiIi??j t%R}c剷ka,g `$xnux 1JK+mޑbWm=A~|cG\vG" Kˎ0o83⧚0$j-H{Cѹ{i =uZdHj؟P:Rp M Ú=Dk4趀^AtxkQy|{[# &dj m%,oų{ džiE8Q SY>u7kwӣ AKVUvҺ[t "o3* ^M`m!D>܎peʊAjT}tQ2b(o pDfQN-r&;.MÞ!=r,2(Gj:_/nzueISi,հMr$n26&u+8BnSvj7 E 34 ׋V^ct p>0aGW=3?:yE;0@4Z zS yy=J6ۮXUl#){b]={Dԝ9<&v#{AG:+ % CQ pհ.aV76$ӾB 0U@;O&}d\|Q#EE|Q~ ojEoц57a:jƸQ#, p]Y Q:@?<[tB{XA?V p"_Kq ԰$nC D ۦ^"52\I+9 EaŽ9%[u3fŢ qq[fLBiaAJ?Yve:U֜AuA}SKC5/JR-KlLUwP_7oNzە-ֿ8Pɦ(z9l1mDM0#9Hcꢅ/&/8Ogt~9xtibA]ckmbjط%e"nLjZ n%&Aђ-各V7'L$!`haL3FgI C,J/>9E9!HzU圓9òe"n{c` XY9xT u,,a2A8A">/7!y}G*We8$5a}އN. Ͽ@R[ it+<05oct]k$r$=-&ZeƀXM,ksZtzkR3)`'^bNbΨjвWogGo%*'q>mJߍ=) #& ?{u P! _ӷlZY" !]c;U9X_g#/&E֘W0;o9=r,Og_ɶ3%]YP4~t$? 8{QtG͢z3ͮ¶BcQ5N68WNxn||_M7d"u r] m]„z m:5- y& kؕ7- Tܥ ř<a:R'3_ƍL0!z `h ?b"W;$~#uOktsaj++LM:ЉyYÄ viF;Aa0̤Mv=n86xH"')>;~aM]{i=BUjP)*JD*)`c=J0ZTXFI@H"UTT8 )DDAe QQÌL $$;wǿ<ο7Z. ]` "8\byN$cS6u SUM]RpDa데;ZT2$ePId9zV0H\5jkԡ]lS=\>{1TOwvV٭ N=7@QjUuX-J^DZ9 jg`Hաo^-KOYXDEmoo?fDiՈb}}I#+3$ 6(a '9|n&wo2r#CQ0sL"*8lyǹJ #IvrKS Il1[DY=3 14޵}tΑ~O veHb0߸FPּ 3f6/8YGS'0s 4s5a~ASV Yj9V}}1[(Kfr[,Yh"؃d(LkfPlGUMbRΝfM13\m5k\f ZIHݾEaqA:oZ ! h/+һܶyʋI;#~7[]ӁPrm]%HdC )SoG 2!fT 6 vn (%|+). :e0}ŠF)6|S,ġ iiT\48(laG~-E3xuz7X҃v*Z$"BW%wo(8-@)ǽrתϚצ I/buNJJ(%'Ȟ_i:UGB~X٫Ǟ{3{`Du5Ƽq-&lj  y,̳q-]aUpN*[ }8.@ $] o-KgU.qfތ`FDk-jP깺>ώ@rrBY*`L`-zWB"=,|هUeBjth\x$_YŖ8$]X!Rx4-p޼<$ 66ۨ`| }K5 PygrBJ8}v7m2qX "b uc|:myLV[??He0 byT%FZ3]85*9}ːk3~=ڙ?^~b"VhRss"߫yQ 6}is}ICy3an>K^\[jJ?ѕO6(χüԼAߍ6{$K.֗I@-F}Oj'MY' ۪熘 wktrBδ=(p Z~M xdb8{{3k!8v}]޶ģF%M Wl[-\{RTwdCt&hAuɎ&tCgSRQGzz|c5zf6[)2{%1 BFݨj~}YYL9K P ũ>1\PzM.nB#)d%P]h>@qWhV)YgU h͓p'Nu/=FwaNg:=ˍ32M2~LJC̐BN;w[mݍbgŹfA=kR9s(c!aލKʟ2y֛sJ+zYT+rإժ\[[U 1O>vi\iۭek]wC .l<> ; '!J!Da6S\"n\ x$Zv\'$Kz ְOVSWAqÞ}0*) \70鶧}Vq@L0p5%|1'jӵBCQ,;[!tvܗFTc>!QzTimB%wP9-XT*z<1c K-6Yw<ᜣ;(YGps#DR\x ăs4Ȑ!'ߐ! žٜAx>,]WO=Ed/1#'krx/>p8k-iD 8%A~_ە&w Q\!`D ٜʽ;=ߑD'y0+-vV[<|16,!9W9O,b$*t%ٻ6'B]<*if7Zo|N9$2kЯ6&a|m?>LV.<=8K.l >jVy8hWAڄpDࣂ
    $*)3({cs~PFeL:ꫣ(/8.YD$ꋓಧ@UG[,v>gI?ECPom}(OCHj1r/ IvF~K&ӿR/6ei9n>aYkR dW>jgu!kr'?lozy DtMI;2`Rjvמp}W(99nǠX_ ¡s~TTT?m1{Բ]#M+Wpe{j#FXrZnU^‘7h;}:#KIM\6VաGyw{T/*onJ|esjO ۠sHz 'Gai.GDU># dޑlhƉZQ} g-;hIԛ4%0{a6|Tµ1k!o0zYk}2X% q/{ѩwˠ0qΝk1 d6-,7Hū}jmU{N,I$fqk6l>2:}溠T{/@OZao퉛At<"KpAOz5{o@aK8(XV07aZ6Q~PK~Caw5v.0:hm}V@*~pxha-^%p/yN "xX^ ѥS׵jV76C]C+?c_wRVA ֈB};% |[k_l?p!ls[)Ŀ-RY:"9h~@?# 0l*s2d:<eGJkP2oAa$~W *M#poٜ]Ƌر={B;J9qH1JT-j{(4U<>| I-nE漢:Wo=o-& P,-F 5eFXUlu O[9e;B;}N,rW\鯷/|uuА;zq*V"|v?8,%Y44`Kʁ:uFh}XGmg4j&9sH:!wҴK+Jxb tΤeE-/tt<ϓYSo#čBFMi|&7"fyTkj-C{%MR( s,ßl#|C>lXoYT] ꫽?`Lk_://E}o5o~le4,7z7V&|v;7e%S_c:7& v PŠXbvwwXYos#6 wGk+!,אB=..O J(zXZۇ2tFX6z$\Y,)/H"MRc~'D&Xg“{LgI6*//Af52aD[REzNC0>^ :-_GARYNtDظokm~Pr6o'[3(Xc,$2i=nU,nb0?#(X?[Mmy.ۂ>i9ܱ T:d!Yz+Y(OlzЊ]Eo$s^Ģm>6#pSR.Qz__<R7 [UC< 1֡IGPkY*C#OTu^|~H#8J{1 &wN??< w+t+EtՍv.?~Sa۷T>SY]8=sq9 jo!vȯ'c܍4,ȿ:U~ӵE'ĥI gWӮ0W\)}~Kv.Ƿ|U NJڲܔ*Mq\J5L xtǟ}Vm9]~ÿbѡ_&}YD.DҸ@=26S9a#LTVJBkPBꙮ3ઍ]X68qDQ,V/c{8ȴ]>aAqуE|].1Oi|79ҶA)Ib:1) h^s{:+lɲ㓔 vN|f_GN!͚ YKvvyj_oHc@ngW-?W7wto0EZsU_IRFؔw #+/Ʊ%z|kxZ'W,ߟZ\J0Ӧ+8F؏.|\#%H -Y8A7d~҃iI[4.~0a_Nqh`p]g*k];WJ&B`#ZrxgicXzOX5nă+D-IȮ5H/U? ^c/~q̚(༒wLͣ;q/-c윀fQFns%RS—l@OJH3}J^l1b1@<I}oz}ߚgIطԻF/T#Ň0ݬG( "~!tV/~ CVΩJ)PIev̋qVfC#*)"6G:G4Tg?+"sC+L1ǝ[ ]R.7Nņ=k bHHkƅn ^Җ+DGF[-U}8uH юF,ljMK?je삂-Fp٬}|MLKť3WnӸ>c<(qs%DuZ0H_]yzv0dHH])^x^eyM$ۓQONUOsc:l4~ևR _ Oo9e0bo bAQ%Oh%*~Y-ld~7tI n\y(c+̦o_ |a@lv>W7QGX!aq<D33߲|tn:޺B¿ZQ_Q])e`s (Š묀J(xҵK:+!Z̶L8rg]TɡNlc Neވxgsxmk[4"]{Fkt֠P&9\(@aA"DUN㻷jQ%zF JQ5˜ \7 }?뎼Үxٸ)iq@aJOF!ߴ+wvpGܳ)x: o?Yk@w&go<Ѩ x+"2|0h|X:dp`} so,S;pDqn?wMNf=s$n꾤Ə-tV2Q]: ҈Lۗ񞢝Pz (~.QLbw_NHF*BQ!(q < u k# BV~}Q9_׉>ćpLJ.t9^,xqURgAxLBZy Yj[BWz̈oLHC.֑/~giOAyLse$SOGT&kg}ȧ t~=hmesPWI~wshybu+KGݼ>{;~J=1F|F$8s2c =uWWIϤ/XLDzoXvbztPV:>*3aŴ{MqӲqrر} /RYRb&,_(ixdv~!ئ¥c*i[87jQ˙rg\i6=_іAW\%Va?%<\I/qoqDGnї~R4RYoE~Z_'1#os9)/BͶjJ7v#`G#oNlz(/| [߄cƨWjm#9(inJg'ݭOx+@.#WjG%4zUm~3 63)+P( ӵ>'+wM} PK\&ARe̬ OEBPS/Styles/main.cssVo0~4 Mf t(ho(?̉v-;&B%}w}g3|Lرbx>?|~htS Axӽ U"cCĊ_P _I3 eK#JǣD( :-臂l؀ 0ڬT@g x+/©DUmsn kC`imSY|JV e&u2KEW)tv9,,|fu*WO_u y42m+k X3tqTq ˷&CmZK Xg($nC}͡&ќhc e3M|Ot2+2E# 2 ?c}Yu!HiŻbڛw}?J7ۏy6{/c=*k#0$nDPK\&A;\r'OEBPS/Text/The Treasure of the Lake.htm}TQO0~G?0DTݚkˊT+؞_Ď~Iyٹy+2:d3@t-Zg J'2mat;~ߍ!upzQ4_f p>X\zO=csuړNՂRPš*G9~AZXDBz=Qש[a7|2SD$C ybD9eevAT,khX|em6SstbjH ,YpT[ Apn+ m@Ih jˀ7ڈ)ငk`(+{^o^Id\[Sz1Q6{IPTL$ύYBaz:@l+R+Xjdit#,cɄN* Mob}2Fͽ7vo(bު$u˸ E^|KM.DY͟0v{0wFRyw K^W%lvS}v>;PHrnfAItDOãmJC69A_ ē6n$\ԃdž{* thPK\&AYw.OEBPS/Text/The Treasure of the Lake_0002.xhtml}TQO0~G?0DTݚk E*+؞_Ďs L<پ;;"g4UUg*2SIjl1PRZaȔfÃ0=Cj `fQ4_v p>XjmzO=mCW{JְZPg4u_Ѡ^ Ob~=F 3f"D¢)DxbD5UmnITkhX|QUm6SZV Y} ,LIY Apaj m@I(Q *4jÀ7ڈf6 6@/R:G^oHd쬩ީnA=ww$Y$"ba&/^Aif@ljR+X)d)#bF[ "Aqng4{o~5t;=H o(bdIj= EQ~KL4]^+\v!L)ՊqE,N>Jj MyCNL-B@ ߠK4(p˵!8$>tZ!ڜB%Mqf[& m"V!lwurL 6O[fb3|aCh)>&:]Dȧ Ef?5O;XJ0׽l5[D(Uy#4|/W2& *@;,= _E(\~F)c'ĢZډHuWˋޕP:cI *L846i?D^YGxp&n, A'5Ē~Z/]t { |kjxN?w<*D)].^; /(V<Ƀt_U"ݘԋ3cj3wlC]4"a ȑzwW7DC:A uՇ:>V d@"!aȵU&{_ҝtgH ވ:0AKfDpx׈.qޕ8*y̷i4js(ޗL 1z.RU✗8Gɐkט]R}`4vkLZf,ͣN3Ǽ]oԻrTmث*M*NQ`XZżIŽ 6{FVT̛(?R1nRqnۡ뱋B(FgUT|cx3UrRrr2KѠ8AU TQM]<3Z5X?'C'RިSySKUqwr،94>Qa_PK\&Aᛂ%.OEBPS/Text/The Treasure of the Lake_0004.xhtmlZrȑ|wonw#3(EY kZ3h@c>G %Y՘]Bbꪬ̽ɇ¸/SޜqaRCc0!,|ߝǫnymڌۛ+8[z7?5OWOwΘEzۭvX]~X OBv9;3޻lb_?yo)+msfU~e_>qnml?M6[?o[wgݏ޹ {bW~ҋϘWC_tan/r[&DKk<ּvU`yw,Mr7Y .¬6l} 71Lؘy~9KƈoMI=yl?4a6I_X Όэ6"qn]Wˏ7xR,tvNv޺u>>oJ Ċ+;>^>mָiOۏes%T k|)Whpg6/cw.yU`mt݋E~Z}k˜ ^Wn=__^]/.s;/˛wX ԝM i|ycg8|//Lm!dۻrakJn}2ӂ QF&}H60[;"oQ={jؚ̽OxpRz8|}VAL4aiB\rصO|"]IS9Ԇ w8b+̖t;!罆 _%3N,X@SwP n`y Ds`zµޔKĐ#%/}F.\Dd/2VB}r݆9skbVxz)0\\H#0r3]a#+S!@tb;UV'<#6ebyDG$0Fkpq`C ty6(~ͯ0(.gs%'Fx1ln2RTJTߺ€Nhx;? B*~Q>sSjOҊTh=o` '#LYw;r, o J%qhKL 3M֑qe;83VNG"0σWB҈ xN2Պi,i҄Ա䐎V NX,Rx'J2ڪ$1Y.Yِ1"ޤظ:.'K]}!γ|SwrF=S%⌊Wo56ޑ^+R٪stx58uT-a=^1iL}], :q3ǻFwBV9&GҐO;8H[_lChg} Un‚R;O@]9DJ`77fLi=j*"ڹ\(= J'{xQS 0l)p<_{lM1?_u=t9tmY ,2CbG͠;t ULY"D&*4Gϭڽk5 0? AH!Y7! LښP>/~rsrC5%UdU j&u]'Z9l(ؕGX[I5pEC3 2WX~5T qI)"T4Ձ z4D0E*܃ĜV/~!PecUt:`Myf4nR$gf($C@Q9;*v] - qvբ͞wF7A}@!<ڱǺEIseޡٶa@F;P¼%[ΆK%5H%tcLL=h):H9GdӟSւE/0tGCLAQ~vբPQ3eV.hUC6m #ux{,9N)HW7@6rO@hUK8_N,|{+~WT_Le80wA(H85e[&5b{5Vyl#w}Bu>+)Ch8lm`!ɖ8>FZvB۠IĦUi:B$A9+\/6J s)6986IPmj#Bƹl([}ʼmC!/]Wj.:9v:csЏxsf /DXj5dNI] .px8URu嚚Qq7N_Sh6˩l_<\< CEd> `u,<2Ɲ̩T|Mw2<Ut42 *vF2+y_;7 =h@M-6K#rX #H]7GBfs_OT.^J[\~KbqfaRo4nzʈ8lO/tu5 PK\&À4.OEBPS/Text/The Treasure of the Lake_0005.xhtml}ے֑D?|8%GX%[num&IB E=GΗ\+37@VT /3WfL|.cjEmWV8n}Q!e6~h˯_>7a|oޭ_ۻOw/V_ݽy)a;Nӿ~釻q/oU9 >H1Ůb>oN>>rU?6}woؿ }˻3!MڻOI~>~?ޅ,noTC֥M_=3/?@9ăCjp1mOnԡݏaEzo^>~?ʝ$W e}_C{o1/C٥[qSr_p=}(}}X>:;dM2>_-?=Dp>ʽp p/LMWǯW/.U}em/>t mC3Pa7yst͗wkyG*,ͮp[Afݡ;Clu.j(6Q4BLEv.p.Nr[CW4qY"$Ťa(bc*T97GQ ESieuӲr j8.)"ŦBi1)Iw}uY"F7PZu(jV{(CYCZ:1VrV6ӤkK;9qU(Ou-K6GC]lec pBʾNGz:t>q8kAܰuVHkQU:M'%75 B9xHlL_6Pa7 aCO.iTN!QwuU2(wY8nZ\LpuNo/=?M,?K3~TmEOiCy:kuF[f#YCLidC<}䞔Ige¢9E|b]7XbpMp |wiB^[%]]MgPl!<:.OE_mjiECq7zAWs>utBb>G,X{_AJ̾ ~ɀx3R| cqO]VĊP(`sImB_? Etl$Gw6.űldc?Kqyv'|m 1VɵݎmS[l` $c- w?wm*>vE:ɲ>ܗs%#w:Y2-~ 1c[g"eWͤ>A_bmy.{V~֟!F=g( ?9u~s6鳽6/m$PڲꞦ$ sI\YpLM8`|#Zt8D0BM#;Bے'6;>@r^^jDkKjq`_a@\s `It>Ӣ{!g5sz#A}%A"z/t|Cu,XZ^/dDk-TOuIUdE$5܀@ࡅJ"zCT%C2$"C^*>)g|e-JIeJfl+oJN7ETOXK/K[Nw|c֌rvdqOsf>N mݧKщ'?Dxa}wQ^f1uN'AM8OPT Qu뒣0\?C e蒸{ax(`H6"qV}hԫ;U[9!1pXƝSC+ö"fg,) `oH(G%aL&g~hQ(͝fُq::w|hX8A6]%~.Jvb7]H<7D{r zqR㉿=D;#pGh1tG\#%>eBEK@~"rማByBF1}LQ|? ʙQ;`Hо4vT1!zT`5VĩrfL+"ЩU]_h- llXp uH&a8~[ բcu< |q>5[}AM0U"tuT@XrzE7Aw fLrvTQ1ꅪJ1oڴDi-ly: ͸B-Q(TxY+ƕ[0a&l@cs6teʶ1wIծC5X4RLaz߅&i5I宥$#î3VZ_Wc|{l3œj62EZ| -3 e9E*M9ûNavmGQǓA !E3Rf-j _v? mh8)НϖTXlxr`OIU~5I+75p_~< P^S Ȅȃhn#OG1 XX?vrKYaqg 0{`I]T%,k|p",)4`zƴ8[s4Zv*EP>NJ^-=&%=U;cPݥ &_'esgX<),^#AT%e~":Cg|}7jU?lMP#lO3?F~ͦkFPw\)Ey>ոx'BEX@w1 x #XNwU0>!Քe'bo},oAQ2ݓh1}'R0XPFts1zO4VO[紗[sdӄpP8{bx82|Ȱ".PXP@D/{ {Sg-I얿:8l^91Ď'lk:f0]x5 ([{B)m`nmmLbAb79P"0pג +MDj.z\.+9ܝnT#SI3w5̗`[y9Ʈ~_31R F 8Tzeuő4:F +kx8dXF=0vl^`""ZC`r[*XfL-qe*)9:LVmH\@%EIa3]INPiLt cM-Rг\[Y潉XSQ?&:2d}eމVx`vpƅ%CPBɡ-&:>Ak4*b ozZ؞ͪx@##S^3'Їsu0*<7.'EqMe'# rwp`KldClħQX%XYz!fipSQj&o14N;rqw1.@Ol¾n<\A~->ؼ39%.0˂Wlc & ox6pd@q[n\[Ͱy1h5S/p * R׺E$+m塷{e a-# J£,a[]PH*bMGSf[R/32 cejoFuXg&zWݥ\oA[(]wO}p+J+үUoL<45 A4,=2$[[xh,w4J)T;2CU >0ˬW;_ ֥W֝aZQR6kB(PAր?u1(p}2* 34j6fPZ "op7ck0o9~w*rDiw:/~=0LN<>]CA,7"䅹1Evz4uv'G19+;,6gAXcQYEkEd-4G+`{L)(H'b/ z*F-fzTMs͛1x 18V A\sP'ZjbI:Y߅؄_ATgQN:&ݗ}J 9vU;e"@1upA2#8V'e ihTZ_1vs}(N;ʠY(mMzeϕ!'q;6*l ;ŗd"r;ta Ag JIbZrvBJyjd{f 8|Exi^AsN޹$d[sRc놨=tiNIcڶ/5ƨh *H!Ԯbbj˟;>܈*t]m\ 7lVV̇v0ԘLfU|4jdMgހ.CJN75Ȋ+?Z% ެq&$ *< rB_= A2H'p@ʑzn?vJD[ ze)?Q͏T?]} $J{eaƼr{<`iU)ML2Á2=_^-Ǎ -o42=P8*,1amN}~yuAdD\cn|fZq A 6y[`tߪ>:UgcvNMfBϟ鴮p!AO-Ӟ,,gyc*n_,2SD)󾉤ޕK`EYNo!63>jUo{VSP| eZĹrK d:X(ns|"1N8#n6YpSiQۍ@MVݷ'$E-qbv]!aV?kX'uik(eBx:D!\ދ*'W,l"v1j#3RSiIy ziUa,KM#&ch|Mo>yͅEqꨩ%(m.,/P:&$.sBv"h!yfxY:P+"X\uUG`'Pr|g#9l5ԥf"TLƓB!>YHvM2p;VGkgE GJ3c.a51!ŕؚ`T!]DJB^y M௺N?/o4[%ZVz"r0S#)9Шn/CG\ZC.$K9 Z˦Z./f#Kyl3fXV7i[Z,׭mD g ; N,8Mx܉|h~莴rVfU|I1 1Q( ĽRd&MN|ZdO|fic$jܧDa)Ѱfi) N(2#MVL9?AU(4m&R]-'z? z c4k8VCUuֈLj i#j\A۩AjT醡*)k=h J;Ґ-ǯq) \A +NDRf?v+,^}~>w7?auA<"h~ h4|B7>̜ G1UAVx=kT"rzy,9/Z$r{8T`rnQ6ZcSيy9ܡwAtFd KǤHej;1\UZUZ-Tcj:9\Z9/ZweW*SZ^Z̡FdN~gޑHXh_+JZnGFr⶜jϴ%8XVZ@7A79BSvz!c̲A K)c D4ZH"U[QVAbwӃć cP)웓jh\Eg9gIBH?Y:bv}g:y"nLXGf!fe.v$'n/۝WAl#!,q;ZlD"jvwש`cpjj[<>FkD2Q+H[:M7o^h9W*G:JfpE| Aq&ziZM8п04JeX-@[[fؘ|!8@e[+)BդuSc '10w3YJ|5FyVxf2 -Ca2c812b|}hڝr,%&2@jaDˊ'Rfj!*],S` a ] lE$+Ps̋d 88ߔ$bʍ,ʏJ[VsTrp QrahzI } at(0,˝Hem9Lf03gm 3~3IKMG<#':D^A>TЩ-Фڨ UKXY !_<{O͢Zam;-dՖMWS2_caڃ22-IO~5n{4.AC xqpj0' 1a[c-2|r.AN"-[R3Ϲݹ)tQkUc4KHҨcm%3"Z}>&ZK/5ҬqαC1L< eMdO ҍ)(@#N`L$62+F7s,WJEJF;S@[]p8op&ĶhҊ.pNҠCFFǺd)ӟ'9ե4t Li}GMSfTry3HAfEAoȦB0flrfH[Y&5'Be} CtDR^ %ìY\L4Ek1x ZL ~hc.8,]qifs7a!;MZca;:} /~m7v^4ґpy3*19U6O*'q=8k̯ ,1?'RC(Xm®íx>GUᶎG;X';e2PYoPgUy]bԽpC.3;[sA$GdT Lje"_~4zv N@pWwQcg2e2eu/%D?Lj 5 g4a"{rʮvTޙӲFL{ƚ'{5u +ewQ+O%Nt>2OqB.l='U;^> dzlDڙ0_}%p.ާJ@`čͮ/4p+\ԠT!f ?n0O+S#t-,iש_ W2#ovAG;olٔu:' OZLc= Hv^fXK% `ex&,,!UZ GbT*KM 3&G4O֨ojFp7p`lJאdSSieᵨ;ξɥNN#fv;505b%8`_W|QQz”`q1F6]q=g'z[kLiPY7Bj;mή\/^",׋"y8v֫ϵ%,D*)tw-}Ňֺ*E^Dd. WسN6_epɋQu0ȁSp l2β6h-ۼxPݡBu]elJc1!a܇[GmNVmʅyexVᨵzi H h5T xs58ɩ?WuC&<Б֏Eʦ~XRZtzYHώLʾm^eVz1B,^'u}#r:s` ]#da990d]\+KxCM2œXvTÕqQu [PJOZviV0,FҲwA'XfwJ"&$. h#7]ԈЫ(5/Xi>sT%X_y1@H euʱ3^=݇L9<$XlǑ!kPi>; ld)+ztr/YQObÚPm.dç2bʢ{>ϦL{ h5Bvo{ {/VG ~D-a3aaǟ '=/[m*ܪI%`)rW!=]5 EX3ڮ# a3b+ #c΀,`.7?x!0ncvzK mgX*a<kS1CW^I$ClG}S`\lIг%-5od)t|5_2ϲӘ3ְ^Zrp}`Y8͉N.SFִ3=3_OY9՝8?Z9}a_aSR# ru[mm|}Et$gmWşޖf UP5p͕_CvBg̉(jh{ `&{qVY6fWw7].3Q5j3K*TftTGy녠b}y` Y맱7#Brw۫P(: ;~JrUG9#3 Oc[ZiEkc,Cӵű~  ƼAC +W UM|z[:CҍF0@0by]3F,sT4wO<ρaC4 E5G?ڛY*Q,\t6p[}Ĕ}(vZM0U0TzufϼB_qvX8[3Ow8S7E1WKq9k/`Psk&3gYjvFwä!"zV8yM@Dꁌ]'ZobwƎT 5u;!m@b0`fq۬p =ŋG$*z|L^o"\@KـpRi܁)om5ۛv]X[{t9GFv](]8Z\5}>~{ xRl)LY:!h\e2 1ȲMB")NfڔYz1x հ$l0>*(*o椹l|l%O8<y3.dV{5ˊknJ 4\iUTJQm]Fqf]ɵZ ʃ;{wPK\&A F1z.OEBPS/Text/The Treasure of the Lake_0006.xhtml}ے#Ǒ?a)HL3Ri5IuI 5\e- Idf@#OSKqzL&vU%"~_еcr/o>&MfrS1uhS˯?~󟿩 O_WU}v7UuOҰg1vH]5 헿olC}I]?}׬0qxv061]h^>! xU;A_>3~D9Ž+.ڤ~ W6 OM_S~>mm\̳OUcT}dwCpSsnLeTi[3VŽ^7_Ro5n#ÕW=~wןek1nME>27q0șfd.Omڝ8^7CsOg聆"}_~߾׿oETuTסu~hv1dWL/;^ՏK9!%nƏ]hP퇸xncJ6Yf;˛#y<e1~DZNYG>~uwхpy_޼oz՟eoϿX>| }iC;eyw]ǿ{w慎߽w_͟ >Ց-bm3񶍣lW6Bu'1Ul:;:\f(LӘ0fl }Tuqpsb/É"}ȫ* "fQq p=ȅjQD+Bi#ڦIDJ!~h]+!/)N24Dcnc"!< ]|dFoB7ix}KeY] tID MM˓g^vQV+;È9ȟ_GYbDn .#ON2l+VS7{,:T4%g.m&LOmkˣc׊>Z7Cy)ǯn%,Rx`]dq"vk r7XuM]=Vy%oLP]$:ܮyUgne.1Q~滚{rA''Ou;˪NBWqxQrF=+j?kbm6Z#m!@+W݁M`?_nh) @~ND{(}';G햂16 Gy5`ۮׄ ndlӪtUPkcw-^$h97]&1"{\>=]Y$v6] v<߆}Pv!"\b٪ NQɲO4: 6{4 xa "xS`ɀ&a-j 63S\(pjYuhʫ+3ۦM}Qa1?Ȉf(kXu3\Hj,P1=kz8FȌ 1^O+cĘ 0ߦfykl&Xhuetwuxr·,~iXy[^]Ƥ=Ǔ@AًE+gȦJFf;nSddx9(JNx+ǹGV 3 0* Ow'Au\Bw<@"Ԥ8mN{ o!7#5fe†`vt#j=Mކ͘dEjvzl"! :@wL?Cj#zrWRb&TjSBת'T@,N43TG/<  (v'(0AO&`CE,FshsW~b'5VD8g u ?t}ƋK򚻧VrVʫ}: VT&L'AF\RG?@tEuq r^73M82C9Y{)[&i8jbr9qS :]/tIk\EJa3PksT=+@iabgv4ԯ`Ije, )nE`"4h]pSc11e&@d9A:ȑ7[A\tMQ[]:-Y<%8M>-R{a-&;K4|ꄺ%ᾕ-APh"k`:u \'/ q4)2qEw: q 1!13P'.xO$ jLD~'<#~Y;](LiȻXm)%8$n2/Qc7OIxel-X9-xۧE<{eRQʴ*KDbNtBV0%]!1>48qhDY$Kn\J) '6ICĬa/eVɷE֫DOi"xK<ӃIUW4*+ ʝnqA-`:4 Sz5YQ@aZ)]ȭ ug9 2qy S/5U^5("@7n:w3=FV&$ٞyrd`#:.lp6Ώ( ).Rth6:/e܃ Q;@#߱&' nȟ:U)ȫ1F@J."-[. GcV-ER[JvQyoft'ZJbue⟛!- 0—9,0zЈ%Y j:?[`BݪL5u[(*;v ͶSNZU؏ WЬINmF0핀3'leRUsہ;/R:&Д8sĐI:\䲫AQƝJy:#%)\@ZĊ>=}JcQeu`T4)3M0>L&`^a+}Z&#1;!O^%y{κn\±ÕB,s|1yN@;R^@yuEB7âjaQ#00{4-SIZ,Ysm,KJnST[gWlk҃\m2F\bfW`~fA *dBPT+TWNKoԞ5h3$:(\<[X2\dA/pađIt8U_'{m\?xf~o/w`Hƻ\1CRfŐAx /# 0=CawH\q#B>|RWFV~*ͥ "*S*( cИz/Ȼib{@tuS⅗ 0Q|v@;qsI|);В=`k0uo:N1,ZςZ.g%Rf ӈA6Tȝ=C'2?q=uMzM*P3vPzF C3Ȯ _%$HKƸiYOIz9\ I+:\cXgb659"&Q I g_K$DT:uךmiM`^'F N]F@@2u"%r7P!~f =i jy{4m?AQʽ}ȂC* 2F! /;ItesLEAcT6dҏ!ڮLzТnk3Aq,;)FWcd͖;O!c[ӯ앤6Gi=@jPLH2mS<4fꔮRx(6rU\ժc> m_2(tM.Bw$7CuT6=.Zkl%U{[0yhG7/ZhZ"W雞MUa/sïO4mH?3zKWzH d(%SI~=TyMe?\-{q &,|LT^gNoS'yfuhcķ_^:@n%\YA /z:/p60k8'ujxDUr, ]SC;>[q@^x$yL^͋#,GO, TCy2;zic3 )i m eFMN e2 Y0),O=܈Qy(3ǨZCy4T4YmfC)W+MP>M=XL5ᅞri3; 6 R̚bbDyo8΄=\ً+o'(̀ͣER܉@`QP_G95Q9mC_^ډ +GTlH $zClf|jLNZx%ݺ.qW=s-i֊<Яzj4v)K rJ-8+Ot4MČ?SMOOL@Dǔ!LARV_/fbsN!@k҉S%jDJ3ZX nB‡Sx02'd=u[!h閦o,Hy^ WY=L*5CƼ`vN44dc,T֟5QM4 HO`IVHWw[Mpvfp6h@A9)sʮZ[Q2(%Rq`.$*eWG g #Cx0ӀT0"DEN1:!<\1Ψ{zm}Q˸> L4N]X}D%QeH+e⧱z5uOjqN-M|,pToa1,#i, 6$Cz:$}(>?6'{1ׂ;*88Msl6ˆ`I{\HxFOV2Z (sJ 3`= }I( ϵnRqwv{]~LGQZd@Q|:"̼bB]-Qy>VX>0W{a]HpqnuIz³(.\KOQn:e {bRS1'Z67˴Eٛ`JܨNU-qzegߦC 2,(.> xyUS`2rM:tgЗ"K@l ''ndOn_Õ,_]:vA'AGe&4}qOJ?OS M@!e(CF,[AI42]s+x5vO@m"!֥S{0m&! u:kf{> jY[SZ<MZNN84yU+ȇwK2;G- FW[|o1 V%'B\(eރ~El%#3MA.)UtO* (ѻ?Cz$tbehM#Wzu-fv'<3bƗBP׋-E%Flt̊h};z720_Bp\YԡE;+,HsMz~AjPƱ5VMK !?V9zdK^SX-q ^T_'akH%,(̅n$tg yV乀 B4lvReLҳ[XȢڀ%R=dŻYz=Q!d.SZ#L2xsN=K{ (ؘ+KW*Yl%D 7gR\:Ir oBփ1ԠOQ3<xIx] 5LJC{gkZf=?ⲿ&,I׈ Hm.5rupq!)a5iT̩O2~.1L(8ڰ%z5nD h gZmd 49uo K,O)@UD«ZVXk-ަR5(DDG`3^7qQ1^ ;TvcоzJc3|OVaC63DP8Qc~I8.xTb)fc14_Iv[Od`"ڑȜPdH#su̞[fNao~aM=8ę#{8jI>Vͦԑ⁞ lRk;hI4 dŵ F"0@bpV4F#~51+,/~`ͧ-6|8"@mB*^ޭ0sM:F' 1ӤYNe]P蕈q)^76pEj5pJϗdE7O{X'!83x+I\ -6(jt l@:G V\}Q ,F~ɬ+dF`mp;/DKb&Ad\TK5j))/lDJQzx܍9rj!ns2.*ۇhp?XF 1""[Cּ=H@&dL cdA!J{=O:k4th_o|R20]O$P9m)tݗJE9ۥl#ޮKq`{T;K1q3l*=QCd6C1vVQvbNJ O7TleL@7 Y5%Q8F?i-ޠXcخEݎS|O}#G%Ōjeh9i-IGx#/ C[y[՛O(f+Ah J,[@fm1I(k} [9u\lEm. C^X޵Ğ\sZA^B+LVn;#:$W¢"Wʕʒo VJC"rZdxmTpi2#R4H>za7تH̛WqBV_?ȶiBsKÍB,O \Ս2'@M%)W#5s}4a#f].5*qwOqPX j{mI,ff >兒lè ȻWˋN@@6.2$e 5-e^6uz\E&G#sf PΕ8ipOFbiVEEK!#.rB}Lj\3#:^6(TNư͙Y)sVAZVemgYw{x1FpO\[oϰܯʂJU'LiNR~~! <9pI\;$b cu% W{nOlY2w"leKd̄]Y*+Y(/Y\,B}dG֏Jn"t|x6,(Eh$$Y I0A(BaPгa)`'K?\OzSh4!E4qC8`b.sZ J$"ev6F-zeqrxښ""8n!AtTOW30.v~C*ΉZp?nne@`=iAPm̊a#^wG`Glک~Ce6GID&U_ckfW2r5+O( 1k?3J4@eiYxP 89@*ĀRij)E P@ۘl@aܩ٦ ߛuX8wSDz}"ߖ} d((xQ8Į)=77¯a}o~;!!ZYѣ= W3,ii2EE$` 26*@D<+mo'w!ʨxtҍw>ǰlRez_8X4dL5)jq4I@M!F3q1|R2쯫 i&V"ʼnf,fx?ë:Mۓvf֩`]s]Ċwdnqj,&$*LPԻ1 цF,wB r֗Vb/+P,+7<۞;[Ox(oJgԓ=ef kZKuhW 4V cm,L,8` {fM$'&KkK,3PaY{u6JA61|lCs1nW#P_*w 9FD΍W.VFʼĚ{;tG/|vM ;4hBL^]qAcFgzj%Q9zPcD?#}bF% ^yUԚޝt&%\l|A7\i_g$屵)ڷڢטTJykPAh~v sB˷8;^:G ~t74> -8(Io;o` ͓6&azݰYYĹzD%C%ÜaÍT({RcR-Yipڻ>OƓFCG`3*^iB}ZTZ!㢰z^,>Rr2g+Q$TZo,: %>vjF (=-0ETc,<>Gn;G~A QBV)P@N-xS"f3 }-]_Ey#,z  tLkV$+Ma` wtrŷytf>YL6(PP‘JZjXW3< ygA= {g[]~ QSȕgϔs"JSd̵ד U=2(3\yf`SEu(7F9T}7Ee.]kl)/߱2kWQ~M_Ty^:^~+}_یPK\&Aᆸ)c.OEBPS/Text/The Treasure of the Lake_0007.xhtml}۲FD?`pAqi[Fױ4ǧˉ"P$ h)i>bpdr*r?hD.yY2BZ}tUM_q_WU]߸6UWϟ?=W?|_WQ?j?{U޾gww_?U0/Mw> oY-OT= w~k6u6n6l7\?u΅g4vǷ7\œ'Ny+}WguA^ {UuGߏ_T8T?T[]}̳Ou旬u{qXUwf cī*QJźz[qoK[6 W^?O|nkdk1ӴmCF6cu rKU̶;˦ ^T3{ͫ_ݻOo^Oo#Q5R/]w;1/jL_;}YhC9!Ҵvv : ~j{7^ZMdoZ%~zrFa0;i66lyzwBx Wճo_({[v3I'WuP\+O/~xS}߼~z=W~G>(:#{zv5. i|Qֿzvo#TжI~QEQJ^-kdSCzjqw6 ,p;"IՐh˩!v 1:& NP ?K;@J!pɬ?me 6u+˧ 찚D+rh[^D$k^`\D_{ dʐnה @;žŀlł!d׭9[?C28K}p <=F,ge}I7Kgli};ړG%LwVi oeaYN-뷭xxu EyܸÑ'8{ A;w?MI5)A!e}fȮ.VQxGP~fyVN9ѭ z/e?b8% \qxinY#GXI8a.mѰ *[#\R 0# c[3ѥ,GzEװ &-{MD؋bUttQ.DqҨFȁ`tŭX @:ZRLJ;/, Zk(²흞kf`a%t,@C^Tx]QDçZÙ{5y\<}82Ρ7E#b IjwHMws]5ZH}b 8`pn|GQ d@Y"Tf1~I+,a@\ХýTF c*};5;m:Jgnp'ck3bA>|E*P)֌)iƒ8g7PA]H:l C.xW{f3rz:*E\fK#RҜLNykwЋ %StEsD,[*bCHs^1^WVe󊽻ȯ`LH>A0l@d)k;т\.-;$Hx"'-pmi]dw~b!1@UlBb,*8ʆ0"0(o`hS+$ݬ7_18}{jĵZYtӗٯoj\8у}Ʃm/\;M˕5bEeRK-јiqds)j U-W> PuJe(l\őBsZ+'aMR9BdB4lp'z"m 0@Ț$9K^l_#+:>7 p !oGJ vmбI x& b !33딭z$Wڨߓo 8l<B$, Wx35qшbI.I1Q@+1QH@Z8Ni; 2@q ` \g ńGl*{~>{_G/Q\WEB(l9Ox= >czCgHJVaN /\ Nz:!pWR>Pjg@)X"gz #%G_%$VHCHp}0O=]C ȃ]s~-x,GF~r dOcWRSw^O,@5SwE4K;jSUt\I ѬH+D M,C _SG@ԃ/]gq9hruK7Zl eB";n޼ f- h[&U*Vĩ vT~6DUW+m\0@h|dW̱CШ]pvycQ#vf&Uwp! -U(P-<qsru#~:ԇ'MG^٣dGCRHcʴ28-֍BJ T"tV@ґ">4NfxY3UcTd A !EL+AYLqH`[%F=r-FD~c;qsbNe4!9rX &6SL}s\j+1Ka_ uX,y|TP*N聡ut39ʥ%}O9Ӹm=L놱*y~Jƽ8Q,N[LX=HN]ST6&ba+' %lnGs12kd nY78Ynn6!'OM2:@F9T&83{ h6.9T͜FrTǣ3<tBe:շ\̀x_6 tyb K[PfAjQc![`ES%S!"֎iބN*koem+\xWRcq;9ZNTNVy/\,V]RdhTΧ^p/qg!TΏ`9k.@cؙIo>Cl: L)0aG6WZS\n80:c/V&]P r^g4G5^#< },PA0#/,d (v, # ]6f堳ѡfx49 ;SN1bJg8/*gQLO%[WgF|9h*+fa"=#ْtˋ6-6%ײ6[F_T1)ggdt_2hjL2̵\*ĕf=̧ GȩVfdajm ^ȓ%Rw&T q1 zYsnkv!R9v^ԆQ 5L2E*)+lޫt A;yZ1Q [{Ylr1f8@vfPe>v#\+d)|`DʹS.[ygl/30-ءb)}{aH|1\YMՄC|27,%I0= %R'J,u2Ss (7ݭZ!?hQMnji4;Z iNPD>FT@@yTGy!Yx6:c`:ghϩs]9nni$,9*PzwI W !B(5ZxC`Obߍf&}ɱgje>Ttu 5%Ulu͵XMo`OS6)[TH15u5q!ѬWӏ<[Y)!"~yQA>ndǠ7 +{Ob,?.1|;yAU_GqCH  irwP-/D[-}"'Cŝbq(i=$ӂMjD r,µ䨪n= K kVe?&/_Qҝw;ˢ?&!t>)C4Lm&(YucT` ?^K4 W Hθ"F6"҃kJ yEc5M|C)}i+0`){DdSp@;j 8EG9YTsE7vkDm\S[/| mi#eB ȠHl8HxLLr"Ҳt&62E SqV1u$e%˅gD&'buV+Ȳ_nugLҧ\ GghIe䭀B E9L, Ndk]$-E=8ˇr[f4%Za+ZBwЬ sQu$ۂjsWFp3þVBHVT1zWFЖPZӺ2= u.h6e8 khW h߄t*rSRL@ZNpAx ̃@ Dʥ7bhv15FtR 39%Noaxd^?aɗs2/oa;fE^Ze[Au\tg@+~X#XB7 M8y^ܓ6"#a8,s8ihZP)-Z]y`S}ӳ@LwiijP7b amL%Y:'ҩ"?ZV`0nzXm(DTXZMJqVF(s e8ӜN)"OIYN7\EXw:;ď̰ϕHY =dhAR&48>SI+QфJ$1}T;o.YQu;l) &RrZ:̊7cP!歹hwQHO9<@ ȳ;9>\TXK%i07^5(ւ6vUir\6Բ\i[ZJ7;xNy+-vzm!k%>1j 9Qhdt!J i FLמ-l}&09_4@aЋW$gx pV-gdaL(C[ZGmq[f_!j4|rT6H k!GG[RMhsFgm?'ӻs[A+/3c0m1=Zx3**a& D|sp2"Ħ=)2R`on)F/,Ą%#S}-EeKEXky/:֊6:v(zL.&eJ؊5W y)bb񐑳kt)MN^]fjm!>ޒäC%DsqVl٢^6|Rʍ@hʨO뒌J+^&V*QrC\kN鰸# G(c _02Oʫx`Z6r{MRjΌ_u i^떬@eQܨ{_Zbz]b\Ke㮔:bZlɠbXv 9v1J#dĘ{2pzRojpm@jynE]ִ\(gAo+-zPpW{rD-]2IxKVuSZ=:ʨ^-"zk+J(x ǾvyjvYŖkG.mhy'pY}Nhp˵עb8e;,zfk:.D`xc#`Mt"U|I~,dm{s췼MJxfVpZO9s;KZ3178+(i)]|o+-!/vC:WM,77ak4;$| OZ¨fqp! M{f@\%M\!K \iye5&Vڼ`8hяcŮr:!C8B:rAbnDܺ$K-WL[[f\ ˮ!¾4xiyE,_{o-IZ練W/St D@qz:6{}MeL/[ X mm sA^@+aQN.>|eiLH?J=;/<2{ż`#G/Yi"lY,&-U4'UyZOM-EB'"ioSH}'opGsbRJ˭{e>kCm*C|J.A$睨Fe 6 :&ktbf`j&ۦOt`X7fޥn"9d-nB_+p}n;ߎt6.WW̷%ǛT* ?eWh&xBB+sڷ3y/df{ۛw)Sn̗Γ 9("Y0+VEI>\ Nߦtd)ԗTU *.|gt7"֣kak쉍v+C5G15Wuy&g ]kX({a"{?7-gFjF!m3[Uu\hbtP%ᅰ\QfSvPйKjWD׉^7QɈDt8y٣tCt1)78bZ] ( ͔(c= ]N]U!67Es^iҬF*l/<18%nKQ6tBg*bHر؆d$]_8rY5/]={:컓|oVUjZͩ߯*{oyzg?B?PK\&A&75.OEBPS/Text/The Treasure of the Lake_0008.xhtml}ےG?damBIY۴(CQf͈Fb/e- )dfR 41_8_2~G&ɺI*3.~9~ˏM]<ƮR|EM*v|1ۻ^2ԩmZ|{~z}/V_(a8~}:VZnwx_wϫr(|]чX.5I..rI*_~]o~ؽ ]&T}|/ӏ]|q];K?b_O҅r{y &ؤv|ݿsM]jt㨋/*(,?aY1KE9]lc-{M^3TC_ F Nן?"=eK _mqU7_|y?rXq\& "IxűɝŦe.ˡMuڝWm_]7]u<8׿Sv7]#~~'7Q RCpxRU((t~\7'~ o;?Cbe8ױNV^V#y8YC8x7&u* ˢ*/^W߼Iζu+鏡-6uE&Ԣ,<7 y՗ģM+rV]?q}/^,^#TE .bal m<(mSܧ/Xh^O\lxWߌ:nzjs(n}UnXx<>_c8CZף<\.<e|_<4M)4I\WWv'r9 bd-}a+X.ݼRȲ6~U늣*{>u؋O,x>ytMt0I3&:%#KX\vi((4w>Zm>cG^V'"o{LŸϫPԢD+Bm_7;`Anҥkuorh*B+Y:E~B;ȕ} L+M<xJ.,xTe5ʳ ܬll={îKcSqXưEN씊|N,+\6bWŇ(Fd^~$~n-^6 {y xB*Ůg)#VmVadۡD?`:Uގ45k+2N-";_^İQRˣ >\(Zә8ë "z"g1 g"3]߭: lUF}lSNA>е?W=y/6kz!\=, AOI7Q@{6x8t뭟ޡ$S%TF7ЀAj;IN>L4'kCt I8 `W*UA@jƪ9c K{LnLOhLjȺ)x聖v?ExBfAam346CYI"zNNQMnadob>>X6q)4;:{<6M^[wW7\0Y`A7'л+W2=)D;y]R`rWe݁ e??[־7(~ kGH̠҃xi#pgUH]*".c'V ɥBT' p5~#֣ߋP-6逩2 1\bQZ+Xp8U;WU=]|oץ~lE_9irt  =m#5%E&.u;SAqVEEb7Q2qgXN( XY b 句oKC WR2KUT,io9 -R*,[k 3,L~1.]Nbabm-͖` {=\m##OoǴ$F7{V]\E6Hbg!"gD)֕9?9o=8n\`<UP,qYlYHn+J ]6dA@h4 Ԗ(X^o\ _]MD' *"Gj3֡t(`BMِx1\3pyo:tW/{ŤWqŷ b!QdԩQh7&Sm>Fȸ葜iL!& K{K upy\Daf؈m:v4C݀cUTOh# UfЗ֨0cqH)ı 뚨F2+'Wn-5 NjG,h gHwqÝU8opt#IKVpo"Xe+:3HTɏKm#]wQ3FAœ4l4#R)q35Bl-siYY8NDDy<ȁ֐J@wr wə!=DXZYA Myݽ0DJ<t 9Oظ * !< ~ $B'6AkEL'6l&WZua( !ɣ*Ҝ]л\cAj]3y%5 lP'`d1=HF)h bJƁ(wJXE|Mn5E@gl=jcyti"e8 eLURQS^ 7.jޓ=)'xiJF_G lnn~\1ȡ»XP-d' }6K0YxLn=ÿ*^\ u&Z9V]5zyn_ݚu.C& QV `^ tةYBDTKi#F|e`? ٍ wS iI!hI=$ Aܩs@ׁA1D"gq]]rV΍Z)<ZDJpWu x5{澙*?Yk~li&N*>7c6kx;dV{$Dkrk`Cz^r »1^N10iי+y wאA3YTWL>e3`OB 9_ jS0&7LKu8e3a*I{\XByT &tZ Q_yf&PbN}CnBҰOBA7ՌUp}0c-ꀚuPrF [ĩk)NLI/1k.ОYiW 5D;TJ-9/Zaie* ʊUb jU DkvՀRDQ%؊mhЏQ ܒ!jfĊϼzsi6zJt"sc/Q]+ :{2 Pje8Q 'x~sA2BTn_ak%CW+ UxJ/ ۍ[ 6JU/͜mHO ߁v'b9>\N3CD0|B_f7AYc. & 52~yaZ1ȎZvy{:5vlƜ0 L40zBvWbD;Q|pLrn}8#5_b`3y)H(璡V7DU.K 'V+6^rjD/"PE){'w-@2zݧ&2A8܂$RS[8\2YA<*aųItf txk@=P$hUH^x15Q^#̕@1|ȳ!Y H]UrZ@B1gmrivaIrp#A R+Nfߊt9ku=Gfג=X,LodAFD"efʜ-͖YZ՚}V"̜a> ,=:oi%ɩuTԨen囿"v.^.-#Dj\|0A? cT4OxcQg্ݴW*#MUwbi-$^mԘ I!#WqirvJljRMlVsC!r8J_̘[GCY۫gYzoghA# x;,0 ] J'8ꌵ8)< |$}%NHŏtVI.R'yP9<X?BNXhm GHؓ(UkF}W^^y /df5#k<,-'9ngeQn\$E01 ={7GeUZ$3T$~^nf&xXb4RuZv 砲zA%>S\N# RȘn|3(Ve5hA-Ƥb,ޯ6kw+,-7KF#*L̥YILޮú6cu4r2]izE*bs(fv`$64 B䬨'ωf>-{&$`S4UUZMWϴU'"Wy}pq Ĭ:KK)SLڛjHJ['mEi|CQ lbv^K]utn,U=U8En ҈L~D]{cX@dzlWR,—"vLTm;+InΒ눨؆hhƥeH8=p*ܔ *YL5r3 jvo@<!>;H釘%0N<oF<]rv?;>(4.;DEz^Eo- ֛Wlɨj,Jvr@rN[%o%1^4s4\p|]3a{M]D`c<֝z\Ԧ2GH.d_|PL&.ݪRL'SDo7&}Aύ {-ߋ ;g h&kKK wtr)N˸^P"p޲bGgqWd{{:Sggd=z?k`sclNp:2 J}а7$UtWi{.s%(:O;0t`̣^z8چWOK Aou^&K訓FEyLr߫Am*4Sߴjn:^W<-Ēs"ː c;`| YE;g?YD`|^ܕku?:4[G _l|oOR@wF.XZk8ԂdjُtfLdlӣ DT4,@}mP螖@w߃+qE Nb-U7Jod 堀b s:ٟS[6x{_$UZ7U8r*EiжF ^$y@9K-?sVVHtC}b(+EWD"zS:I*Tqw}6:5MDQ:h&-Lcg%T" >TS^X_Eh[' ܊b]ï#T!Ԡkc*h\ىERŔ8t, sHC9L&3 #+#YNxSF,.]cvIS*?;m;&"3AQW,q[܁*u͙{=\wϨ:[=N lGiV"p871Ҟ-Ѹm 2Y1{f>[2) (\(Zl1dF洗 mǪfk 3[{ZL&CLH)]fKWtsd xjVYMjH^"Tn7]R5L<=ѯZlG-frVZ8dkU\ϙa}cԗ1 %]'zƦR@>Śux߳"<؉EfE0I8 %'j-tijxiԓo SO톨@ZSB.S12K&:Q154g\?O=\2;EbKMOyh Q'6#X`Iz<|4h5u>=yS{1caI擴%{hp]󁝫i~,E%r=-e>ςDwjm]uw^&<# ^|Dx3b׶;SjzQYF a]uE}>2wC3584t`0j8+݉8hM;V8@D }ϙyو{I ⺫r(G=o* fR=p1f}0T|)b);)J:j8k *! 򻈜-X3ϬDBeiSFA^aϦ5qBɑٖYᄂ9:0Ը|rΜTL=3~Y=";ƙ.Ӽ%^0+㘧Lۣ("BD#*liGI%+a8Vy? Pg `l>(m팱IrTF%,$A1J5$]J2;_qgbC fG"roy{I*fԤW\ }JPyjFAix ZudTb=~4C#7jJџLe3M>xDY81L$%u&[+S)WYPCaB0\,sN?1P1J\QmKGIT$oNWuq wfoU x%'?Jh?gEfl7I<ݐߞ9^Pԑ6+6iY,L"c71D2\SvF{eSx&~_:"u)/hD  f[Io݌x#{}Tņh`r31HYPMIOTP0Pzٻ-Oq݉SNI@,Oge藟~.񶗩"g4Eom/]5I#讽굅}Y>٦ASv. ['L@D[AefÉŭG,WfӡXh'Orrftމg.1ig:e1̨Bn(ZUϧrU[Nde`Ɯ5gfx^ABxwɚAn8l;h,&Ըro}B918S!9V/1蘸l(A/bX C﮹dj~׎*Y`r1/$Ġ)W`Բ$N2ӉGOFtLq+*])lX1Ur~N#m+ifX9{ s()snGU}TW-gIbhcdKo@];[APN"*zКZ:(wݽ*(X:OAX_Uʼn,t*X a&-r${OPwz63TAj3bIoU^5'?׳ Du) bt0/Lu8~ڟyv~TV_beK)ӳ&4bN+h+UYO~\׿rGseM h>{a39|1&쒕oO~ ʳAGOuSz@%zr:X3O~S_33@l$ sfSg)bEO$"o Po ehm>Z`ۧ/9K> (Ac-<,t_5#2| T.rk=Ƽ׍]}/`Gylv-qì[b>Vq8_u+9DG&%)\4xHjL7Q+;T7^q^>8scNUq -&Xar?FKF ;QOy]iw`Oc!~Q~vj.Vc/ׇjD?MzX@$yNvCd/9dbۏnaDˣ:}}hS$f-J!!1Xᵻ^Tx c7_߫lCtQtkIEr﫝@ņη'ap>Uֆ<h&&ObD$IwCpwc/'ra4| vOxXfukoاb!;5[+s ͏bbN嘟c8/N"\/J_Lx*CT(;bFc8]VmS{rs\OY>]y#7I Rމa 7j1< nTX^}q+XEu:&69zŴp]Yy+Wa"i苼lkWwlE..7d{-s-lOoX 6[TìƽV!p(Yވ21~ouێm4P?#.Y?LYP<] DIu n[4'8tNVJnxo3u.W^0 w ÄxP`*H֐d h Z#?bbyb[s.~$7rYk+tb DfQf ͭzu) 뫮G'^T \f}熤6Ugy̓PȆ FlDp1L幾6EWA&(ʰ:^l}ΛUVrJW}]GKSָJ)VpEmvi?5kV%v `ܭMY8$ E*S/U50 /2^[Y]@iZAsSBGt[6S|\ǥ{AP &,&C`>M Z<$?`‘͘O}I@:u b0 !p'ܶQa;ac6D{i~0"ve4cvfwm<*xV9m^?C">yb'DXA*HLW0g;O[FC>;ٺh nF< ,v_ JtzzCTGWVm+N $XEs9D\iY|% hSޣ(AD2QDe:f4r@"?C7?7ѫWaBHDF@xH Нmě4!dq[S$ǎF(g}PlEEap^HwCz -ӫvh'7Vž* پU;am!UVr?$c>Oq:{UG֫D%nggWa. y0]G`,lUu6F\ihM*;`~͐'9apIVEZYK{: cN[Vm zR+ o"^7XAH Ш(--L*x5Nbb\2η{ IRbcvS[ǩ@c0$hHS|#Fbb-i0Q`2g|{⛧' (PGDgkpa@⌗Cf`WT9OYnR9+=&a&4?H0kCJx񤶺A ߎz"bTV'AIګMaٍ y ,?E #NsnX !}UY=gȌaH5Ujo%vi:,BW%d9123&yu7ԑI~n9! @Huqg'ŜÚ_DS4{!mQm鸭 D^:B0z),_QG(f)O)i$ZE u {VskO5r`cJ4T Y=WNvT zN]1 ";|R5i,-/sU'7CX*{l>U(b@ lf#C=JɟF2<-ao+,N1pΈ'CU|Wc( ˓,m+'1yqY\'Yroccv W{N6 h/u}xH-◮ȳl3u eZk!R7OhڃO #s`)o' %\9F^iw ,0l,;7!f6i_0!Ą1;`~ /i2Viv!LTEu~}tZo}~!*W3:@++齧,MzMl ,i3fi©e!e;qRbmf?6"y:QoXx?W*ݰ#e9M-Jstg,: ^ 8﵋Ȳ/A{ȉx3n Պe* Fr,4jm%[+U3017l -p"h` pC˻5ghp+eaL/`z%=C=B28HeZ@ YS$apriwcP~lόx=^f_?l+ud8Ej(H1cvh 7c\:, g tY[G7™Xv뽦 {+ 7*7=h2m]Yi&}p]L.,='TMY202*uaQv sXa41S%L\g5ѥKԷ6*iNڔ֟_2C3~eá p %G6*;2h`eɩΝYK?%R.0:NP6ۃjwYڤPtUڣd_dAe/lX'Q+tA6V.5ǿ*3,Yqy(^yW'asɼj\^pkYW5 dgΩ;0b AzX@h3nE2cG/*3Gim#_]ծaSr>AS f1Ei gm1-G&Ȱ[z^Ie.z8PX^%G:z B Vl5aNA]bQ^qCCA`(wy g}x7R}u.[" ',1(Kqb8>L/%,9ɳL-k勳O  c>Y8{)`pڃ01oqKú CzbZ"&Om^i ,љnA)U箋ʲ0M}ѹG< =/h 103)o(1VL])~uvd+8 d > 5[GZ~"xR~p Cs G9[&=8Z;O?>VM[}8Q[L1bt;ʔ5gn4g J 閜G}USxpgNQGmg )Pj `ʻ^.'j44ͯ:>,^=7,F!v6ciqj(lX8_VD%8ꕖqrVAheҩˬg%1!H [qts"' uE(uǢt/eAo/Ҍm fʗs,^'4GÌ39T/e=7<̛$p%VO4`z`>@>,Cׁ+ӀDE=, :")d)~jhZ] σO8KQsF^DYltyEֆk^=#Ujer0SvK}^^t1jWj4e<|,u' څu#96uda9llFu[߹*{öpq{rs#89z%>z m;!t׽IzVymAUj!c@{Q; ٲ^w8 =gdo5f pV%LU0L~ ;BޅGNE< x*B#Sn;TYXk'Z8-_YdTig~9`j}Z?We/ؑ*[{nR9| h3w9MD|-BqP5ohQC R58  cƗ 8RY'DU_1eV4>Q> :KNPu; Da^qpNc31,n'^bV ajF|82ɴ´vkװPI!;0 ;_Ѧje+:I1 raU\7AqۜRgiBj57Z$;h-iIgeK_[|#ˆ-Zɛ&V!CN#d gykjکm~՜4!pHgQ5(R6x[&%q:\<*g/,+yoఽM|qjNj.@1]|IƊ 1^]9tEϢhAO~ y.  諚-2y|ޗg V 5"F}Xe 81W1nu3R lR_`3S_C!_ptkccAˠv$y,j8 ){ވJ')ϽQ_hlbmQO)S,c/:A"9p4G-6AHti1)I@zzyDN/d kQ {>1 0̄6`+sAp3tX9 LuX&as!ȓEi+^CIHsZbixgRB:k_5dEjQ:kI~]W vrV|7isx)/_CPK\&A=ւ/u.OEBPS/Text/The Treasure of the Lake_0010.xhtml}}[Gr#ZxH»HsIj niE./pWГ̪n`I]<Ƕ)C}rŪ]W;|?8rMoW]zgzo?)Qbuw^߿~ϷrWE9Ӧ'|%jŷ=}[LC{{~~ڔ}qnp/[w8ɍ~h]|'Ni/w[9.~Ē kysYGW}7nvݿեC!tUpŗ(au_}׿_b~ɪ\+}k׌alsYxQbc'OHb]-x6%UR__}W_oWb iׄҍ"Ixƛ]On;]rd˱pt~}k!΃}wuHoY{o~^?|'MUY)\*w!1~/K,=}Snݯ?OSxME=xi|N6ev9Ko1-}%RUgslQUMiƛBL^^Buldk"5kwgnepAe?u7LvF>[\jDeu?BDj=]ߌ(_;t㚷xq9,Y\]Z_i|smn7lG{}YN8,rzVx2חg@1dײU0)Ц?px/N$VM*;S^[ '^,0! #-V VU1^^?X+֌S°brE0ˮQ`؊ڟT bS=@pbOf?͒4ɫ;0?SĻQ&S+J,q -hD#$aZ? Q䫛;m; #Ŀu 4q-M &>zCPNCSB+W8|lCbmNxh|3C]|j#CD%MZ:r'G!_}߈Nv;:/{[P C;ѫnP37A.YF؇؉m j3L=A:ke+*q:Fy%sɍ=H6!Fb9G7L%EN,H[Qs' x?54 킜nvU"epȾ; N0^i1gYnA<~t ri^pP#!9XQΫ"cXw>E P_/AJ<5x>,x#hChUm.}1\H`w %h S3  vN7%s?<•; ''/3H)NGq~࿇>.kCiV kk@69rY cQ5 CNu +EEŭuVV .8gD)y>=ld#0 (G661? a3KkA/nՊױ@ek!4p#GSV-/9;PDqTYlsDS EJ7a-j,AeEPjef  NFḸXYqA!_"xYO#|+諢UD}i-,R{@P_s7)Ѣ ,C.6JRZA"8L 6*>$J<)~vRk.2R !#GgWszrtjz G=:$+v ,K ]M,~e>O-|)b&>}Vp[tשa̸I={oL#~[ ,|xI~2.)3=A0ĩ|=&U}8ȉ\w?U^Q^,~>Kb%$W,a8J.mٖiC~lĥ}u((y 1ȵzE) _kxoX-Ճ)`>_-`ׄP<29e$zB~8V<ͣ04:##?\0`<9bC+ wR^W17Y۫2fuOQmt%ʝ,vM[r\]ߣ{_ʑ`- nQMjP }%削KNxLO\NzNm)$^:)~Qh}ݟS-A~̶2H2uWeݴ}ktH_XD:ܘdT~M}! p G8L9lJlwhqЏ{cHP>-OG,0! 9%‒)lO4Cf)v_ oaB3(ĠD䯭im15⩧<2!z`lMF8дR xGʢ࿑"HoZP^siN @O˭$AsIb M køiuTQ$!Z Tܧ&.Dbt'{o]oMKT$;NCx>j"9]>djK3wL14XLsr1T>ߧ(@5c~=3G&2c7K l^^I#KB!rvdxGt'?ߚ lB2"Jb%T~uJ[(z /˄Av#vLPa|(MwhkLJD qͨf&o5/xg-jΕOzr,4GvI/P&?K! ʃ ϖ(!g"C_8&G /w\lf\ߥT2s?o_ӇG:=zZH97Ww&#X,?\iI]-Xsm=%k |ppU46Z&٘ۄjyD $o ,]”^1ֹD^@8pͪU+kIseOcւƕ&H,9Q$Lx:tܣekrR<,٫I`ܙpcBD88ˀOɜ;|̧@*WvȑȒ5n"u.тow,Z.hPQv^|I1y (6oeT7i·e9E~9Is `PK{;kz!9F B:PjWY}kVR 6(N#ަ8!A GGvũ'f eIz Db_>-5msKB rAUb9bmp;VÐЬ]^7d/A *)qPCBbN8.1i9 9/9*#hyXWt80Mbp(tqIWNT!}17kCԨ %\”OZFj !E_pZo&r\ ^5VRƕL89r@ڎAmi/,*(nR裘52Z>Sv/5˼* HHdFDhtɊ3BEi౫̬2!,a͕ZcT8QC"L+.{ YO>0(K$-~ :WIX26؆ȉIѷ>i5R)arDGr7#pg/2ų+VqPL@Î'M,͙T{)G`FgQӥmU0"! 9Y4[5)H\א}|d4p1;^ 1yJgR)LV fB'.1C~1^wTHdP/$eVbEh@S,uWmo,cYls_n®5g\&Չl3 *K+g(pk;O byLo;&tZ}p?-Ǡ_[qtk'"*:n֤2 Z4{4g/X:"3-QEߋz^'ux /Mh(btQK`t/G0,'8<{&|32ֆ\cD˛v٦Y7PR>1 ^fTG5J|ek<ܳ>VIjK:(1b9<೼O,\#eш*F/*| #`&xehOg=pY)/ۙ%FC0~>xFx]@DMaVqvuj^}馷%4-gAxm@bQJa SR}>e%1>ƍuijo=. |9L!E %޺^bx#JGiGͪi@$`kĘ15p2I&(Da7JyB4e @`4): MK(m1L+v*4kNC D2|5(:6P֛4\կԞ mtR.٩;OA\J :Mr.z}Vjѧ)GKT@ #0D A+4=MإRFU!ZhlT)?n]k9iq3K At S tطϕLjҴLn!cjU{xTTw>=pRdgWFε19 s7II`;Ziؤ_ r4=eM 2&!6iK.GP$#n-=ȑFS& 0;(Gyj9!aˆ ٧D f$%+t"1,\Ԏ-QY$r !|"݇05)Ln~XJz &.,₵IZpaSz~F_q {r1>Fqmo8\JQBR^mR^!Ռ5qЂٷNp5hi0Ȧhg&/[~s L`*9 ^i/󙂪=X̕@Yvg[XC9K Gp}a;kFp(|e˝o,Xln{}'l'EVa{K{Z&j򝍁mGj=GVxV_X}/2[ao^$"kz*cU XRIPNG65@)%$"BU,eTK:rYH|@K}3tx[RTD? 0anl-8c_1[_$|ESU`<Tu }nJ0f.Xܥ:gv-?8&-F㲄[,9ϩhɾ6 RD `8'\ļt%cjcVI`Hk`|.&-nEԫU9^^4;E\BFz dDފ.`L|V5 u}ɚ!aF]Zߌ%ĨD4%[Za7MTo2kFT9A HEfl{5)B",z(^@•NC]Ee,u%CnR>P@ޣ0k#v-3]ىkf}ioˮEK#p4*eh;d}3w/avԳ2JLaDH!zX@nu}⛋*:>ƺvFxFsy(!7#\^ ׄZ6Ud(ȟGw*斩'%TJ0s߉V4 hg)5j, O{ 7} bwT*(aX7bj, zL]>eh}^ϕtH?|,곮-88&Pu$AFCP 2 M2{9` FC d|(E"=O]<=]S4[Y KnEg]!g<(i4Ad~)Gdȩ2Fr"F ߩk!\|巔G(r =&yk4z(hrToKjNcv=.;YX)לCqvЁx&QY;g:>l`t+, Q%MDCC ) >=ʑJ|xkF[RٵnQKe:ο( "h{1EhTQ5A|aWJ(6'3ttBksQLvEa R'MF+ݯVq!:Φ/J0L3x=w++^SIC)mMwb 8ix|nN92j{WJf"][hJPk@ԝRpg0W*{'v5tzT%^ Ouqavڜ12Q)["*O}"7gF4?tu].BּNȀQл܏F($7|[ ɬ>oX NA#KVXU眶IT^KNi}J5;f̒)S:jI3 Mp}"a&' `̉JkH9bVCe!K]ΟTQsCn^% [>:7߲!bQ~} Ba0{-ߨUæcv1qI (h&[TusΉJ xh;&Z9#q0YͰh P{ :b-%Ey[1Kل˩дZT:^p9JB(&Z9,0Q0=# LV;D U!m<]r.:@ ǂIZ}˧FCaUdvYdۘ٩zQT-F#? )IV\L56JpT7c:`" ?r;)&N1Oرá>Lg30M+b9TjUpc%[$9aF8D84h-,kyOncLޒq+٪dF9,O%GeRI̳>hPeN 6u.ͥLlC! Z:X8/}d4B TٱN6$K(U6r6"f5QtR &IYtb0]q$Zo@fB!dKB71MgfVCm[Oо7dR( 4KDwcF^8Lh6}?pOXu'9QñͲݎ4,QO;&H^։Ɯ3Wid -%I&qFb$ၝVTqg<â}|&i)G#yM: 2'm޸Ǎh%+!wiA*4+U4FsAz`uN{B㤿EgmY!:FTTP o=m}r1?e~Đm58PDmNR?$#`w+PʣӒ\32[s{ VrϬ.:s]xne +)70 &jZ>ZІwGf/`,.gN԰DŽzk5p尜|4!=xv;1$h'N*`/mX !duj1\PM8RQa,O[]$@]ɪyNX7/`r'̐;vdЄk)GR8rj0$Fѧ8/v:;sd5>?zguc'Me&1kQz`Bܢy42.5"Oϑ5#ah Ѫ˲|l1jGh+Y$.qF|^3F/8M8s(Okyt9PzR \ÑO3ʘO<֩"'n1FnfK`Fj ޢԡ3>ɆtR@Q =8[}.qYҞܞ }8NDbtC*2?^Φ L_EtiqEYt-^4FIUTK28Z! b1MM; D\mRN_ eo}ZɅr%TcŻF8h:`|ܛqmYlEUu|Wޞڀ!3, Jׅd)s{Ȫ9Ld)ƠP^A|\$P0ҲPe &^̳ԈN ncǯq8gFqx>a9|ќ)Mcf<jS 7%2t ^Қ쓍| A=\G-j:{S-Hvsp*54e( U-vvl oy!hl( U\+h\xgzG7k-YFZ;X(Kp#iQ5K?(}2f4y& g2dWԙ!d쨷V*jTNA y&`+:cJ=G9 'n`FXMx*d)}MTK1+׫L-ŧyvus8 h;% n9~;M{^uCi\:N bTu➠˿ƸWVlRuCol^Gff& 1&{.v58U"Is9H릷֚۸֏%z M]Ds)`D٤# ZEz>+ht l;J: i*SPF$nP4|Э{6xdt$c%(C$d˝vNl d2uZ?yX V75;ON^[0e4WaɅoj~fP3R]U5Ks0-AY&>'&,7,d%!sQ(. VF^M=:άTK>ф9:G;rڃ.i\U?$^FYu{.yhn֟cK+ L͡Q&*Z>gm)PL ^5H+bgʢfgX7$/u~8$ϯ*)d v]Rېjm$UK)Y% a$N&'{x? `]wV(l!,6|nfbIp/A;~Tcs1D۠+ΈɳNK9XY="u]8Lkhi^1ބTyF]Qbz>D/Hcר=vc1=K #06ԼfVO~X͝йBU d˻"9-Ax&\K\$tph BJV~W(|ڛCVϼ(hw~QӨdj>OIp3<P6U_nrNWN s8 olm %a:NO0M7( wu.LsbÝof'2\d!1 M~RG/wš$k (fպ:h"nmf ׌܀!7InyqSk~N##G1cEG8KW# n1ڗ-W<+[Aͯ|ITM8i01K 1N?zeYt% 8Y jgm#AbK?KFJ»*~|F'cv -ޱ|^d@5\߫~!:g=Hw ӛz(-(6*q\~{jQPK\&ACt6.OEBPS/Text/The Treasure of the Lake_0011.xhtml}}ےǑ?a)Uwf$ $$fzZʌJu^yBi>b~bcddUe&U~9~/߷M?+7M1NBw7_~~_U'7o^.w~S|vë6E9NOpxx{\}5USз<4CC }ٷa~7nupC0š uwyoocS=K7>Ȓ?rGx8)v ]]]}??]՟auf[1M6EZC~\f&~a /cxH{-^ܛt֌].o~>*Z,4 I/\ծOa3]rm!c7r_DZ߹pnӄ0C4-W?|zpECV Ѕ*^~ik(xQ=/n/1λrk^cqOr_!67#{rkM2?Hۏʧ/?8%!<盗ϛ/^~mϟlh:41eyUw銧7]=|qu}=]'{5]eʄ q[)B[JbMӟJ- EL=R,]ix6{,>6 ,M1{ٝXtSlF9ma}>F{&\7skj0\~xo/={#% Iǩ8X슸m}foeOl7*Vng[f(!>񟡟GM\+LK;ssMhc~'ۡ& q,s~nl.{lT(SBB}7M+P5,}wyR~s?t&Q[۞;o(tnS=xYJxڡ/K;!|q(9LxKOƾ.] MmmJPiIyۣko!8XVz='3z-"4fUL>.6vFbb8qu DZㄏj&#(N|Ig_qX#BA[fH*]b kuzv%j!W0{bz fѶ4im{l7ϼC8Lܫk3f߲U2ySkvx}alNPr0;bkUСp mm`qid}cG{ xz1K.6u|PvORJb;t)4iw s~fd/ GLF[hexMrͿ.+o}l·GWas瑞M¡6\p3Ģ֧b-0$I D7/ֆ$A30'c:1I# [h``d&aE|?BA]6Ծ{ *v@-'n9t:T/[Aq/I:D;ȧpR|0TL mYpK+ KR͞Ƴ9 e (w]NaeWOMe;nU tVnGԈ-/ih͎Cζ0Q9Ml"zLFDÂ3ͼdz} vF]D z۞z</a>졁a1*NZC"6I Fggۗ&TNnF6 J@0՛3nukbٗPD~ķ 11GAs(T} iF/ޮL 6%S֦B~w\&v&neI'kSP@58 MMvôYhiqZ nd@<`\Zs܈>Ǥ }ڮY#q&-Ec8th׈$w<*wGLpnk=_OXAc53eu s[Yk˿y{Ɏ*I`E,Qj8S? .r}G:\5@}~v6-0Qe Ga [*cԢIXp]M>?;fHp _!B {מdm1w:xq3 ͌c8ʇ,g2J}jr+X+P]{&Oqd"=ݶ{LYsL ('T5O@e R $O'n8&f2HaQ+Ͻ ee@ YD$hXa do{(v6XHYf"^7jџ*^n:b+MfB,u.# Ba 3N+{0+`(m/N' +!y8C(ZE5fsY, _RXاsogH|6)Hm]-cGv;F$ mxSP {xufg=Zxp-7$(27o49iOMC $vx 5Ӓݠ30UTfzjM+{'5{P|D1#L]OjJ_ gZ!o -d # S ]YX O%=0IJ7-&`g∾{tw]XR!eY A4 ;ANڲti'H4lby BxpVTK(m S&s020Lsvug4cowўz/\O,Fj8zH/GC?Pt?W 7먰kyϮ6?[9 e*3X8ͦǃKT?"`HT<=0~q e I}|8@CbAff(|zʆhCI?yl흎H}HY0j`ZwacZ.q\ @a [JA7Gģ Ɍ±3dR:l24P"m̆S%œYTe?Aӹ> Ҷ$fE^w̬u0o~ ʽl(=b9rD j@"q86O:-C#~?qi)ft@9Ɉ>ؚ( GY21OlA>~NL6`LM 7sRmSO9V~ [z K%!MX,r57E@cau(jH&t{n!)5xc{N2o(k| x !s2M]+]$vH3vO!N$Ѐpv#ق< l5\:OU DD.5n|v#2#ٿ|GL9lf8{Ƣ W6è$njXKq5EU' o2>Y0߮ <{ؤcp$Dϣn#Uc;F"p|UA@~(W;[_wOa;VP.iD%N̎}KP&oMc:g*Ige֫sMd^,/-d*K)H{=kVl-Oێ<:.)3aD>K_gA?5`am`%XB,"G Oeֹ\ށ!4ͩgwAP&D{|3."]sboPaÖ fbV=ok/B`Uo#OK9`_P>!0ɣXɈ]]-~T15\n&/C_ ;!JL<ƭ|.d %2eqwaQX Vl"UK̜%U=f"-D -N:)AV9 ;J  i G9ZPN#%36} ^oS]&!}I`HI l)1UWU$HpE{q(8_&m=}F ;e,ɗ44T)%!qSqN`b IMVe* L/9c|.|]=T֥zB͜&c:U:虓6+,w6mdx|̴@*`0˚+|;yraԁ D-<`VBV-za&` (_ẻKIp珞ᓻ]Uu̮Ɣ-L遉xlR!8d My(0AhG{zm;xJ6 2SoEV2ԗ%<()x{^ j"6R!&@,(2_C^@yT (<: g=:y1^<HbJ)m፣ N BTYywEb*)9\8h1SWQLXuWFTʆ#,#ɃF'{2)Zx9' DBT.&:C" a2 r~g"rQ>̜ b7;[vOyŐe@ uDM3tt6ژU=hW+EXUb{9Sv/uPc%) c0YѼ07| 9s]a&gh$>)5 9 VKV蒲 <\[ŕe)[ w;͉m>c ssU=ʼtǁx2oM<:p;ͧzdKM"j^t)\PCplb|*3ɕ D*xuܸUfx 'g . 3HE_ty!f+#RFj$\?Me6Q5nq{qMdƅi %~$qc=.Wي`N'|O0򲭗Y=" ;$"Rc"wgdq nř̐O΢.YczT굆BIchv\p1(7iRN^tA$dN~]D0kѣc䬘2 TCvN R#zI$֣D2c@A:3..LZvAj\Cq28I |zc$2WlhHZw{w9 ݴH@#Py6_)^o 9d{pZų 5]ZR-=BRDd`_a'GioS`{pRϝny,Hmi-TgYa~#oCqSAujQ){̾M ݶ'$4w.2,FSx%[Ԏٔ{肅$Iwp\ܟ I$Dӓ5z`DTv |2n_384S!o͡p% "T#H#GÉ]qT2:Zgޡ>*A;lKH1թV~SbhJ!HR, qT*1fIl>#P3OQ΀l,Di2}h { "p'{\+dժSop Eny0^%| @P>2 - BצacU 6$3ZGoL0jC m扔9}lRtih*5)H̀/%oᄓI(kr9%D#N>qPq.ͧdg&94JM9֊\'ٿg)ȑ|2cS1,oh51H5 "uX!=ԑjfQYa29itʚ9,8sGKT~O9 TŲyw!&=ZP<ʳ?Μ3;4ak~Y/oݏA|e|bIv<9Mz٤ 7f:6- ?S?#zT> C;.LduR}ouŞTɀrX-9iF?A[^5x#L r,1sѬ'ML_R\cr̉bOQd"3W'W򒭱$&|[$(&ޤ.GlL)_͚_a$1y()9䓔g@NJӞμ]FsӊpՔr%\Wqf{DR?Pg͐-UȜM׻1?@2ɽq+2!"̢q.p`,Cuzy/h_vfZ- +8˩!-]_n~YHfV){8C0r_0}|̚‚@7gtN"/.&Łg+7̘6pSY@XB=`יcJo ډ'z\7nYfo/PCķ";COt4`Ŋ|fй9YZS#R@sr,<zyc]Zʶ*r',"wM:ɭSF%݉*^&tJf$5=IdA͈R>G,f"B*h\ {#}FmJ}PuCo1i=-Pv>{U2uC`n{X@"ϫ\:(8eftL_%ZG%#q4L*XAWDj$*6ryVrS{pK9=2bs &SHF@j`mrfP9tEv7)îIg,єo|J;IWlᔅՐDUAa{k,zbiCB,`iH=+vY?c<=KS41QOVyL<ݎ&(m:/ɇ`ȸ.O&RV!U҉ETs2W<ǧ_ݵ$+X*` yp+c~'{0']*i_o^7TWJ$䨋1S)TV|fC\ g &OgUfl2+9ZW|aJU-& s.y M8e+?iև`Obͮ6]Ń3zu榴k\wM֨>NKޏzE%E͡Y-2ŹpU=Kh,VYA>aUtHǸ_]B+ՏF9Gv%x[i=%+[AXfZB^֝[ $}n9[jQ:}*+C0G\gIly"Yr46ijy"uBs` 7KPC8sVrV}wܪ&덹v-Pp.U9R<樮_v{p _\[en+לX$ ! ȝN8a :3KQ^hw.:4Q=,%y#s@a6~sy4=2 KEE\a߻܈Ɲ)tn[5Q2*UsWԯ\_5&{40w^,+ʵ`S70#G2Y*ڣw?E422Hh'h6L!QN O #Qr@gyz:d;̶OUe,V-U@zZ>Mݳrә)1 fŨJiH1tJǷj.4t:VA<XP!hEu$VP4Yat2D nDϓlpo f i=΀OlB[8䃃%"^Sk⒐LhZ9.yRvmzA'[wuRAjHGm$ݿKb- kh˦nw*K!+L&ꦺ^}Kf7(LH `9Ki\C:}f OSmVQ{Őv< UhI ouR6C3ջ[HOD1"pcҀ NY. siMMUV(K;VY%@ )AiT܌6_M*i/yRi""Ant=~pv颓$>^5fd@morpŸۻ$G[:w=C- 4t)&qe׷s,ǓEnuJcߥpӑK!R`:8S"$MvX2@ˎMڦ+!e;o=tivs kZo&3Z!-Ts2A|GӬ :F`5E梷Tb8@F廍n8ODR{5{m(H`}P)\MFwG)*'eW3vڰ,mWK0D4J^ >(MrBn#ѰkއӇ0 -:hNEU[ۼ.CU`"%WUji?2t05@yO}`uٓn_ j_%lgέtK04P" hJ9~?gr2a7*/bN}~94M@F alvS\Rk+o|tQj*tsP]K-*`Op Oө: X ۔)٘iYLD"vf2(s0 DĂ~$7;vC_NN 9)*M9םN.^5Ix/-UI$sѱ)C[7EN~奉~usrG&``g hkԆi@̴^/Qk2~-51(g.gu6fD\xSyB|n2F>jEٳSL0^ч|^ɃsƎS4V1旮twT0<]r&HhP{0nLoVN /n)O19njmHI~Ie8+j*|ڡ4 O)Eg2Uy_%ꐻWF\1\sBbb,oGbnGŨ7๜M]Z2 -֤n*50_`.;6|f~6Nit!er(ƃPNz.Mo.@q{wuٿCa%n:"MSl%+%)Q} 62p_ /]4ݔ2~ǺBqwa$,~b!N5T=;É-Uk6X4f@Il(Ni`Qt7^bϻ` /=5 ro6DI,5Q,ߴI0J$^E}܎ń_ATb߭fj+VI29קK5+SXF` o7/CXw&M5v2ߚ0j7QJb>ve`t)XwO!U4ՅJ蓝! ]!K&զ&ֲ|e 8M 75jXQOa|OCo/ɘ!m+CUnЎbMѳ9b]hoiy`o}+mC!*Nl'A$,op}oҝ0]9wru)ޡ s"[9Ŕ猪 rbhf^'9j)8'yKER.fTkH]jSlMY1L| Ʈfƀ-(W=SdVbb]OQ7j-4'&,nf )Lios~X}S`](RV;p}ɒhpp-13\yZ76ZDNNjD3CўWS}571G c+kMyr[O7/W])ơ|xbSw00[n] ]_]!~PK\&AJ 0w.OEBPS/Text/The Treasure of the Lake_0012.xhtml}}ےǑ?$aEUWL@`@z 5.֢2KO}dnLvWeFx/?MW/vo ߕWy:yS*ׄ|8M^۟7)߽+}q{Ϳ[QlN|> O/wwTmbt*ChyhIjWvo۟og7uuw?wy??޹{.nnVȥzb_/хr'y y'W|7}?ե8pO!?0:/?Om"dSti}7aSrm򚩞B^mPL[S+RYle_R͸+qU_|y_n?{K}SnMgهp_ g0j.4xu~Z?C;뎳;zo^xww?}~I?rE+\֏iJ,_՗=,뷯~~JuEٸQlhl]#ͻ7?}W߿~{!o2>_ꂘbYzO͋ ^̪OvHMkoD Ēžuz*jn n/E+v7+P#,A6슻ˣ>)p\g1o7bV$~Kq|*^4c|ɾq}1`vֲ ?N|_Q*uF/ h; isi:Wljux uEn:廎uh=溲I~Loᝬ`n*.ǃ0c'fk|B7".OQ|<67 b"V|Ĉb)4y,?2ZbчqWjS؊?c=a%)%i[䴩# =Rv=|[Mn"WFe1ZӬo]'4Tr'(>j<6+ #Ne.7Jlε^|=~:/WOЉ0cw" UCYllK7F"I J!w7LD> Ey9y JQ+S.K1avŷ#oGڙ.RDva5Aia^4b=G:55{s{K3P,G \8A\¸+^/ŀP*2xMpm#SekȒxU#ً3_.ۊR.T!nDC+A7(;]oOEc=AN|[?KE= vPYtpkӷs%B%oLr0K4|RW\ jLp}-~u%?<W:%w#'>„u[> f@9rS-h3^4&/Y?= Vn*Cݙ!iĜ1!"' <#y5ZSib0pPϨwgm^)wr1x( lp& ^>,NR$( &Sʎ̄8O-nG[,;C= wgaa\bx,'FVT:yȸp*=߮ CD !X{TzFl+| WPT%`ro%$<\QFtƏ5!ewV#^'BZ5)cYkn"~QuqQj<4iW% ?jo| dɰH0O\kNl&.}n/ӕTcsPLVQ.P< 7e=ȗ\or +ɪ'Li9)QpvvM43ӌ Dekwۜ] Ȭ.判O4Y),ό+fvctEH~*k6{I?5 @{;W}XvG*a2(,t Wn fϚpP-K5lzTT b'l]qi EJdgW\ǭUuάs`Ihb*1.j8)i]``Im̒[%0L4pٕ6t?I];TA,+LF@>''aqCo ZdnpqT?08s|,'twU{fZ= WuAdx" ئ_k-]:5V$`aDM?f>R^q8Kt%y}nmoXAʉ"6tD{/\b簝kۓcZ*,zXQ.2`{!j(2[5܉F3(?(W9\(іQּ2squ.VO O fJ~X85R k0+q=VjXVL4nQȐIזOiWϊ R;=X=~o` BɃde(Su ʼl *1 ;7>JO2gnD*2\R1&ME&5#Mk`'2:I*++)dHGIAc(F3shQsZZ j?.oFs!27g@p%3VU1ZhQvYD>EM 7E{=$:Gp˾%6 XG~:ڝZx%<%.6j+8HfL8Ɉy'%-T_G'uSnm.Q+\dK߼V_>R\X)v$w4D˴X;tGYcEz! >6pFUgw''9 [)b OM?k_ShB6EdYѳ\Y̬VۙNQm6Dq eM`dvn,냊I6HLJD$[BToc{iRQ˟)KV)QD.nb`-ڀ j !)Lq=5;:Di%;mR`dGA/(P [bxrm4#| ɧ>V~VjnE+ؗޡj >H VݳGD?_Yt2X0'){aV iIZVSV9TikS=T[ WzAؖ5( YJԴ`yMmF2xs[4\WC9iJf P. ! fDJjͺJ)HO (%*5 v$>{7&#qSv2z2.:-1 R b466˅r ب B»f|\PBDLlv%ϧQDlM!grE"=msN%QTY .7p#E3,ɷ&F= T7{*ۘ ?ӽ'ߒqC;$eN ȦQqUa' 0GȼaHͩ5Ѵ9X IxdMZ0'ےwP'gT6"`ⰬLh%ؒL#1l9qc $IUT "oMg[3-NK^TVwݠ5Hkȳ[dcA̠؟s?{_mTMJd5CQ8&zF& ܃)trY6h4G=/#3٩ nlwU~N 4r VS+I+ۅ2]U1\(0Pց٣C  \ƆG-XycDž#|eTNd 9P˔#Dc5X_6S=_ Zˮ!} .I^P]LO^TnZFAx\7Uc$?Ƣ3V_蔧b7 p&q)JP|[)v 㛚i6JEjAfʍEQ@XIzQ:]HU_`7ZdPe>IpjPoa߭Ŭ3 ˉf"bsyL஠Oi[`ed@"dZa~{0dL7᫃8FĐ+7I7H3=iE-孟Q?ѤE>$yjkbؚdFF[Bj:>%'^!ɐV ~ \9q/>`c/o^>/~KA£6]2˪'҅U^GTH}kyU3ruvAEkQ6]6$Ԙk"T1hˣnko(;]d€r11((!K{,4cBf|@9<4l:-~BVj_uY DrHNG/a^TmX0S)U?V/H-]5#c'2YU܇UYߘ *VwE؏qJ$%ZOPJGj(k#$f5C.0CŇ=*˚uN.F\ 7cd@ZpBZy9ɟ)*4n)-{?F$(}@6?\^er*SUǤ@l"%a; ṋcAgSV@?'ZpI1pNc]!נ, Hxj lZݴuZG#59a[jW,UnHq$#R.䇂MtlEp /~]tz5E},ƽ@N+R*wux;d\5U<{h[iHvmq*&[ bQ+H[eÄCɸ ⒋6Ѷh-ijODGc}4<tHVU,763G[s ˩9=C+946qƤ- bp·tH5`q-_&]-Ш+Ӓ zaUT/ŠL$,/4cc3yJvW'*Gb׊A &2nvЫc}}T\2]oQ`:DTr $T΁GPc!ڊO"hd;@CD"SLk Brq bJ\kӊA#VqORz{.D t[o"OYu*  9zrlt1r ۧܔt8C(xK$&O` v: /*E6|*6q$ˁ|m>5mdY- lSzNդ|FvQNuN:WIƆ]Rvuª5k +R\ֱ݇mӣ+ vʻf֚~ |U]Jc#gyH cQ/i&ѫҒjÕ=g NKښcȕ'Ɯ *ª%rTRM%rm ^l)},Mʹ\b(ߠ p断cvF\n3&~ӧB`5iT]Z F&̘I+`\KRx\ ;ũm!(MrHN Qױ@Z7qWE- v0apC]5k (lk! @X|yҊdx (<5.Χ]Gd=m.:Ȣ.7hLӑd(ׁȃ/>PŎ//{@4>}g,-FnDsY$8oթڨH0.~.쾳5g`Sr)6 /+N<.wx"kl˿7Jǝ7}{b# ~fC]ç@ey\Mࣶ$ "%G%:&`6i3WКNGm )MڎhZqݽ㽎&N:{_|5}M[;60,Vrs&Fdyn4ZXDqQ#a=G A*[S0MC;Iu /qnhv%z$wk>Bh!`@w AeQBb.I]qnZ : -wdB/ap3بQ ^w,'PVePqX{֫DU#\傎=qZ("HXV`5$4Wծw\$(bQODX-N=l_Vᓧ4HجuSׂ! eXȼ'M)I7в ,Tl$LyluqSz1] oɌ& }0}E-< eԣJ'ZbGx"$n\0Z)yĐ0&tI{N(&Z)- 4~ F2cXuZ+_ sw- `AeU. CJIW,ڐ Mk\䟑UN,?4? *ܢN{*WCRzUmz@G:& R9\CJAm 0 bkݚܯZMYY䫂Y+ɒ͊cOM0Q*ߦhJ,E$]x-Bjuk1җENyl5dXzW#K0B#@Ut#"ƘgoMom~e N"IfTH͌kH!6uf x5I+pP6[bt5JxJ7JYDԛYs&v`cWWJY7`JMd4k!̛EwkX틿m5 3։DRWB ^ʤ4FSF8MSn)ݩ)V^IÈkw%ꅔWmGJzj̞Y&nDo%=|U_14$ĝF%AW ePٞsa/ ۊXUﳫIvˋ(tϠFF9l)x-zxe*baaoqϹFk[ Ӭ^XyqlO~7"j0?$ѢX\YkR?¢HCqա:DȗIdTVZKSt7- ,⭃]OG]^eǁ9ޗH 3WwLA͌$x}=- 0>^eJ\YeZYaA)_i&ڭѱpr.Z@Ub,fT-qؔ;[N!2.ffBe KGQV/0DxtI͌7 &U١֎B\# BeLi[YMVViRAd1N* xChOqDQ##KS'e nUMӈ$[Q{0r/өEߍ/pߓP89l\[ AטA@Y{k eaL"ܮ!5Lnې'Z[n)5jg'y ˆz_w 5c1C.X!:]&7`))PI3"+nŸdh[Ċ0x 6IOU.骙֌oUFtfVĂԠVjR]G2 6BФ6[&<Ș"B vyLKq A87Q}]ȥ ?jk) R^-mW|$G݁M-@{m%:ʁ67!qo8L %CVm&<T8?uCp-f|KLqX~OMRlOp)1wUҍ> zbHRuhpy,gm3A|_ 1#;,Nlr> >f_*]N4C_)S +1Dc|@V;@uYbh9EH~5WͪM2<ɘ3j|B^n#;,Skɀ:hjvqѐ4|!㿬?!zߨƑ4FuMtW/n91W7"VL~?.Õc0)ſ6/z+ZOġ<\Jޢy|%&FEA.*1d;N,:<;*7N\.I@HX38؄u*g%#8Oˑv4ҥ٥ ߧjÞ=R4qGꁔɢShgU}b&o"g>oSH0=I #شTTjV^qEJ(hu0JSLsh:6`]f>REM r}#d\j=oܬ؋ ЛItS.Jbmh蚅XfK(^U%uؼx^G4MWmq(;%x_ }[coiPK\&AӥF.r.OEBPS/Text/The Treasure of the Lake_0013.xhtml}ݒƕD;@u#%12)qhJ6{W"w5*dR a$Х<<<ɞ;''Ba ̓;կ][=1M}Cz3OTir}7}ܼg߾?~W5,oۏV/o?SUmixww:nOrǟ~ _~go-77Urcyl_k+FG}n|o?x{Sn&?v.wQI݃)nnV tl˯J7-6op\ O1߀՗w,~JWK6U:~tS7&odU>F$?$/vVo+&ރ4v/˕W=yw_|/BZlawmػI8k|F?Qtw, i?,gZgw½o|wnJ?U+vˏLkcpz]?/單H>ƧzvY CՌtn}InIv;Mo:OA֚e^K?w>7/̄Py6߼yGmݘwW%ԹV?x/o]K}a"lX4ݴ~oVW]{Wwc{օW B:'9mVO?m5ţBNMxjyU8#ٝ<췕K\l k6OMl>};;Ȟq۪'/cϲAnk\V^ ã uJSv+us6Em{'9~0nbGg]~ʁ"*\ 1]6x:5aG$ li ǒc%zGWBc[$Uvz@]-7I.瀫g]?m^)A宅Z{Y S]A ޯ>VgG~zzwNIvrI'wNzC|"i6\SdbMcyl:NS$>crD!Ҋz?'M<)*v^E!(ɏU1&A$gey<Ͳ@])dElBd3V{N֓%}hIHo 'B"r$nI< dS(r3[/eۼY Dn.ogXwj#l҃/E4z sswM[l!GKI$:nYL"QTV6Sp,8\r=m5-&u@)* g7U;!WmyCf9)lg4)Qd9JT2Q4m&D/Aw 1!]徹eҊڏg9hyWWDf֍z׹q.QZY@@]zqpug#y"iTмuqkCx@Fp#H8&^5=_i'yH$dXa{!kxӌ!M$;p(9+Q&ٷ\W b i- _fWYG@P/ٽ}.;@Q=(VtPl`9X5ᔫFNa48 !~ٌja@bL{?I$:5bswd  `C @r0+܂g(!;Ezwz PdH rJM\TADr=̳<[|*8 U7Op$h'3 D.'HL.PZ$M>Q[%T>:rp0zyvB/995 )ManG5l硗Wj & TьJsk B>^gFIk'7Yw(O CE4E)n+ltbWV0r x1ػ}QfM !6 pE` m(JHC>cą3pbCZ[! DEڂ]TFfšiQ 8D 6+}đF@v9XfB" -nwK=gcMPN θ%!z|Z3 ?k#'R}ScR|q-A<أ!L-ԮG} pȃ(+^7lhF(.y7˾>f S57kkE+4834т{.YW.+cP6ؤ25]+( ؘpv+"md%SL *U_䶅?x9m/U7mov _}͇Il`s'2.6W*o0Q#P>@QP:O<okJ՝)F3a}q9ȆXU|1T Zs|Vde:lAj\4{01*Uw]5] }ۥJG\捒 `1Ee6{+ bQj-Ǡ U8f^=3{H<kcu6j]CЀC wҿ@|a]K4<y.¼ޢ,NLvA#ę%.H/N uH5 u'E m槜$1>pzprb"+v%!z' !G*Ee0b|Xɹ$f%$;CUwԈ&| \Br?yXlh&`30ci@plSy+Qv@$;bt |cnL<5p}rG$S/VC1ϩ= HnłN0M(AOk/^OS xQLB.a65ߟڛQI@:d ~oA5r`%(|с؊~dPWVm,l;P|?!;cTF1w rhTEY+A,)j̓ `y 5JAުͱfY맊̧ŕ3C4O0xKqb PDϩO*'+qe 1ԥQ,-aNՔb+;^4'fGPZ+\-W< ɿx5B/|d֦jcY *Ti|Ӟ\LVB,--|gP8f4OHHa}P$*F}qBSZ4/CS;5.bga'qjbPaאT9wQ2j] 8&֍vE@k h5 4X>w!˲6V0mU͏N_k!{/1TRi$V"i?'nm=ǘ!z!(e5ܩOL8)Ci z&X8./ #'\;~[~UϪ`4jix]ӍBkQat:n[2"޵}B^(h;߮2Rvy;EL} @iw`N|,صm%"0]ȍ#Ę>WL}} RʟG~{?ZfA% /|΍I[=LVbw*y-8w 0#< ђcAeEQ0:{m);/Nm9p^pJ^9!Tk oɾg%FK^ȻcGԶ K7po{oP0.(16*LjkSӑ j<ǀ(11b4SA^aE4E!a|[u7PSԽUH?3TkBIEҊy/m^ ޓð1DЦh%w|'™f 6{^P" H?ipJ&:LMq,/+8} Tp5) E|ˢh@HHi_2deK*;})c>=K8ƁzGLҕB`q1Nevf y{HX&4Qb%Uc@ a*yT0|8Mk:on!ڋNäa{G37R|-Avyhj%}=wtz oSh.ҭԖҤ`MT2Lt&{KQSXib.Y-:bxZbqĢ<*Yj(8U֤wf/P6)PDO,`0C\HIo50`LŁU*F,EB!Qeu]bNl/Z9u9=U9Tꐩz~[X)/f4Z0X0sЊ%V[X> 8 a$l Ls/z*Q(EbOAU\ě-0ЙhMYTxS  ~KQKCC8 C.# |af«Ƿ-/w5S8Rwp-Uthc1$\ᓙ($U.uA=d-Q@(R'*N37EA#pUm&/Ֆ2Hc*R-U*%ql!IDRa䙗1*\Ch2+j!"=|33 [p-Ԙd:%3-:XR"IWG 7t&[ICN0I ],vAK#Xs-blo; ]方\U2QKnͮU#U*n:8ZJ Tq@xSh 䄇A4EBCvsآ cU޷ʽZ7٫Fj"?%2ۇq?wh f~t1iH%{Y4渐嶊`%ЩI\eF}b/ksRW lD=c#?D&. VnkLGKTyղSAN iZ4Fo7E 6A%֘ 5wiq Zm籞"`Ť6e,ɖN-7@yqd %x@gls: kK󶲪(CtnZB-.hB]3aMm,nE7lD`M@b@SCݓƗoWX2Dẘ;"7S*̙i (pVIԻw.O#Q х\*$4UOdK7ڤ>䶇.zL`v:vQxXۊ_OMM+MdHDV.#]f-/fLQkx#j=S h=ٌ}K z@WSaSpUfM㳳2?"!˱ȼ u/ YU rbSjYa xAqJn"^)[C !g՟YIbIY* %FOR5hEdLXϵ WQjZGL/7 u{Y`kE5*+| =EPE p??Ik >[gvA#GjUotoqÎzR"rCW|JD %k܏Yt\}*OrWp"(;ZGRY}kh4Yw`n;X2ʍ|46DZtgi,JZ%VF仂ӜqNG2VGSdθfn'א?{Mٔu3-bJxڹڳWq}v S.L NWKܺIb4zgEsGE"zlqS1lJ,ÓBPZn56hL2cPi٘嗐Bw>>+5떝dtQleRnjP 44:ǥDwX\r3A/7 FHυ=Tg-fu$SglM(2 IϧMOCҨʖ taF7ʮHmJps"%u^Tl-JLQ-#_YNq}CŢkyq| aźԸy5d̩r>;CjAuۻ4!g9_y1NFwi Xs⌳,vH@y=, ']҈&U/VZ| tNiT>vĚDX7y`L8~#2^%:Z}c˜ֈ*V4ͺڳ+Rd`Uh`KuYu[ ]:9\rK.:uqlv璝k {EqKzuWi:#ˢ#71bg8Q0BACыn* ٍA[ f`ˮ4Av'`4ktGoVP_($ݩTuٲok^|wYCϢ)I^$vDn֖1LVaR/g@&W 9im4!2kK^޺fuN?jvbrh:AX;vv[XQ=oWD_m@m 5 rΥNv5JQk~O9\+ל,5Zlv s؜ i0P$?9#%9X]¡-s,EwN?T-DXZN8S&,|qYvN펴'[Fus8WflcDÉجcFMe6Vv>6wDvVchj)%q 츾*tmͅFfc`o} '1(GǸ-:2# PE倃YaH.2`Q?ѨFL^V R)#QBl▥;ҔkCfnd"gշ+4.r]8uapneS5|AchSqIcaNY,UU%*23W%GA'E1F`7(yو"p=ĝ0E6yچ)1)::v>>yQfWUviC7X?)Ɩ: Ƽ:hKy%K/I3OJj'GLeonx'MqAΰOI}.ڇ]$>#5,S VXBgDFJSHJj1sslJX CE4ᘵYcZ%Fت.( X#JZHpLm\7&h8'gqhށy[1hyC*Y8D'rMv%+|N?[i,z^A!|k.{eUvm |Ŭ82R3AfS]3mC-,&tZ'>㟗V)n^@>(@Y 5u 4afB&(N-v9itu+GZ[dogL7,$p EWn|к®U[46 `w䫭DF_Z;Z5$lXfR*T0\_;^8L}-< ?a K g#fW#sJc%<7aY1dMVv~Jч@g1L,މk1}EA7UṎ6ZbHU)h_YU T *,;N'j0G7lSz֏~,lV o."?b q`Z;7RE|=Ya倂rj@ 3f$Ku0)o$ WTsy7Ƃ ΋9d5ފCEB\eC, ~_nKn?j@z5I@m1A@%V J5U_bSnU^fJ9r%b_Jҽ5sęݯ{*f`: *h)۬,!w"kZ7QO`fըᜇ):5d9e;6ºjR`,32)C :F?N0Y% N, Wu~=SU3q}t:cdyvwy /"MH&̡<W 'cwt.j1 ծd#_,s9=ɣK˼ZiI\G35$#4_!"ZhĭhUy/hpdh|xZ%bϧN'`hdk7 ףۥj`{QY2Vz^(1se-4DoSi0Ό<ʉ^"KYbÖ~\Cya饔c/ZƚӉ:FwC_[QUCNbs 6`2~ -([j|>@t,{1RtekZ4Ӛ1K_8 r'AMbrkpͥ5T![Eo# FN U!/Qbޯ dC1UEw∯jG+53ABBZO܁j`"5>ŸP_M?ŽsG^i<5VFvzt2𓨻^PzAPHXLiNlv:_Wʲ&v;Kq'6D탵9uy!w뢛HA>ZR,46Kh:y O&/ r>@jC^Et? r?tJ {UwCd[ Xrh#ŏP{wƒjL,@A tiWP}h}]ׄSX6M=<<{OZL&ZfIFpbDsF}j 71Kɋ{T:}exS^bU*6s}tTsȸ ?_LǤ8UkFqcI^ԒGwJu%ɨ|!*hչ:9HeQ| <&43mg]=I%qp6UWET C:'R;u$n\d=wG>en* M|E9֥CdKwߖS+}m'y9AnF)ry8:OTAuHJ7ĜC%?)AeiR]8:uv,pAnü F9~;>4+cFp?PQI>b5B e8\X76YG|d+g0Ir!G:; y7K~/.v\m曗; zSqϿ@wO-qo-/oνßXPK\&A!M0u.OEBPS/Text/The Treasure of the Lake_0014.xhtml}]FD#xy%OGtKF֝-mF(Plp)K6ɬH^l@!+?N,>k?&߮n ߗji몈+׆_~G/ݏwۏO?O7Ooo*U=?_6a~x WxIoZ.77Et*vCihɓv])Cqӏvp[߻F?to?|'NOqs#">~ȒЅryGW}?~hS CpWuw~;L'O~MVE:~pcV-&/dEz"Q'y~?"źx[P6&U M)˷7O~sO~JD%m۔nM5lC/?At{*aV{o}hxy>CswZ'e?yӯ?|/| ЕBr}=\UugūA^]Dr5>WnkM_ԃ}lnOxMeo]EZ{y<Z4[Sis^by~{HJXS4շo_"->yZEٺ(V;׊|xo޿yx!w&]>1UvǛ֏N ܩ8v<(C]cj~{}U|%m3p\P4c,*CKw\1 v}՞ִc"zrWљMF|xG'Z"kB?w-r AX7e-+Ck۶NVzգۻ44$ҕ yX,n?xyg˓p먻šڧ,0#\'+zqS i-"5 [אoyE Y\*xEc{9S[MWָM>06kf&uE{GxDQI).GOܽ>#KH_(2WPpQ]^LYTG{Mu;cPys-{l#2ȖW&vrAu Buk I6nԷMSNMGݺ6{<ӫ=PwXp(A.W\!YZw転jvQv+qqMȪ?XGAǢdc+جv\X. {.tALi46Ic{'ڛVeچ#v@.>FL*nF4JƟԫ>`ܘ"-f57F 2ŤaIaKY! sbP׍;0x:T"^ي ) MM*h[N(W~܈O>'U n>xj"%]lH/ΉjgpK"'Z{{YNklJzk'`"Kw+CLQ+S܍BR(ak-HMun6 ʲ%sOp{D9%F|C`H=Cm<4U̠ hY<쬀 {&we1XOPÛ\W?aG^͊{.s.*[ț QNArh?nCdA\,&(Ypr36 K ) tKQl odupIwKL|+e-b8QK܅\f".0aY !)22+ ıVչ'P¤sKG(>'|T`" r%{"\V,Dkȝ rK_HIfV|cM17G\UTWl! 0aR8MAkڝHO&at3:<ژ,^QFRp=%\ѽsD`%[AlU᫝ "aWi;rp_(Iґ]*Jtb"b9mL&U|3D Z1}V;S>]hbPF쀯*qr{˶ϚZt!t"%Z*@QQ1HBt ~V >N0] 5U^*)zdDI昇f+$lt?[+U#X(F DttvJ(DFf "t#$#G"ip®Ø`8v~2eM$ \J!xYihDWI1,tCtl T3o Sdu/D/DJ5{ 2$9R]K_v*E; W bqp8)K$tH&hb=Ȇ9W ;~3m J=E#ւK(B;EI|m|[Z4X>ɤJQrNIV,NE ^Dj'JsK S䪽;URSTc_KĎ@NPԈF. U F~"ӝ)A\B sp#jIg5F;ozhh=4gnSFKqŔAU^ I3DL*UdtG 5#RU$QR|D5q?wdn3e|l{+ !8Q\<4D OdcPeWl0L7t|6*Mg%".lv*ồ S w.gP붐IwR1NCh@tr|M0HVE 26UMsE;_Ҩ<(ocI~_HFl\ i1Xʏ3 tINMYC )nʁ[BY_+o(1f}.h4q!UQ'B?3Ȗ} xɍeR!0-<{_JQmZ:g^oZ8-tרJ'xh) Nt"r[k5˕JOv u6}S%A&Řqdw vF dE7+F9^hȮu,Q(L$IPGP}J)pzODO+!9g;8xXP3 LyG !@]ăqc* itJ}IpG`,BMփ#uAle4h('m⢊!!%eh7V4̌h5S)((LѝA#yUBf58XZDy%;0}yqu_|p nGeMGٛ)Dq`D+!EZ-mSH[Rb!kp-BS&;uDVVE/ a5O 7Օy?ू\\>#wN lI`JQVY;4CQs%F53g|:nh>$u!@Jb!S ެUHS/hDZ Q*C?ߓNc w6| ؒ%p׊Vh]T2,#d@y/4+$ 1Dq$7 (ɮ{6Z'* (r$<;<c`zK/$(mmcF"TD͢[ BWƉz ֗ "gDRCs=ū!e)yu(ghC$gl\| U"jׄ֋<&͋HB, FHM6$Ha-wH]}!礡ZAY!5'oSeIiBۇ?oXdyS} k*2:oބ8ʸݭH˲ub+>dPrB9;\r`†uDc9]Eyhݑ-OT% }u0ha?VNQJU;c-L9DI4N@1V׺AQi4t7~y.K{zV%ُ9zشqZA1 3@R`CӥꨈCxħUPbK\]8t^TIA;\5$<QILY}mKa95D;};;q?{R`1fϡ3]XkQkaYJ/)vL9E~#N\" Py=HTD1ny0f >5`J"(Ar"U{s)v']lRS{VQb=ngdA f#ht~'7 BO@ {8vlJXk5jxq;2MqJdG!qK2?Nf~Sӄ *gg.kҖT+xM)ǑE5h+hd z CmUu2\^L3MJyF|J Q]9;@UuE[R[Dc|-vČ,OR۝qLywTpg^۟J̙ ]:?KBR4)Z:i"?A_A>\H$Hy6e h">*B91vM2QfV)!]:ԐpVNVmEpE<Čbyܒ *o/ mӾ'11o2dųU짤z]&ej`Mr3&|X[i0ii ye#r DGzX7>ͷ5=BĄ q%bW/B/~ cim`L?>G`yXI}l_m+d pG58I ^ab}cm#fbwv(ů=J# IԷ/$/ kef0N=RRt'ھNŖ?$驎 ۦ׹ `vdw3h3q Mup'2I Q&8TI@ yɩ^ߥ 1ѶaNb%HLx&{$!#n4h3 ڽ(rIF1&׮V bCjX܎V$G٧0'!G!%D0y$w$r-ED<*t>J@WF NE[U%yژ c q?Gq ;cHƧˣ.~ ' JF H+f͡7hy1#.j ê&-fd Itc8op7' K>B\ѧ+) Њ.|o)ɵGa/ N ئs6J}]Lkޭ|0^Q ޏsnV#uf3 =:(1$`7'J5{{*kG񃾸+'Bi,1.1z`8-G`ِ?hh1i,hua3QZhE,mR_|lfڎt}k}K S8`fƦUgF44lU v,:QGTw"2V9~BoM] U HNYԔĂƽ3(sfoX8 ZRى]XVoнʘN|?p<ޕNWkAacB+/Gf m SWQ2~8@(= \E7lq>=׆`oơǘ[LWa;GU 6F&4Q0SHU+?{EW>=.# k穭K]iGU/ÈssNnr0|f",PG`ƔB@nAvȣ:^&6L e&JiXf<噮|bCjPs.wd㇔)G!S5ɺ4IK(؞uE4h)XVM%īv@~lhq@RANB_.חҭ<*]>{'J*;|-=~d#f"4g%j "6Hl@\lл[5vNΙRWPy%wE-m [V?mmrE .Z6#ATxZ 'cj׹?j`KJǖ9 E&9B\}˔CVg?sH7ژ١D,&jic{23-ZCek̉I[cNeQ@30Q}SM^,}'[3.s[(XBB36FvXrPe5kV޵ ^G [5볔EڱFGm(CsJSbN^|V8&H"*عV&z׍/},sЙ[U7.L!485Cg5IU ymq/ꢌS òȴ_$i,2K@V xsf0~D:lģC L>}H|gewS>$&"ًFRPV}LNV`9dZٹ Gvʇݝ3QhYSȋQUBP;mV.=Gjoba̚Ulphl4QV5io%M1,p˝xʳXsic&-XIq֊E< +0cW P$]ܱ[TX#hɻBx`$1Ϻot2n׽P-4 Q[P;"}K'ĖGmv \Rq ͑(U.OqSYنx;5a9ǼI[xpÃja|bu(Pb*̧T~zL.*&i[yhjbYA1{[aɦxQ ̶ܵ&vsE!ΨbVU hh 8ѣLL.c,#56i'ܺkwndZޣFr}ӱOu:i#cN)}0b 5sv6/ Xkݝ){lTדV2L0dsdL0\EYeA1$$r3ר5iePBs@f*QRM5Pk^5)8'H]q.$8-,(~λѓI=T!bvڙF3,rsxűZEbw.Mc rwB哝[sek0SiN] 4l@=I7y[ L%5&>M}~ﺭ#ٹ29 8K@˃13m1P?V\H 2YD'Mw)'?f?`:W- TϱݲUHP?ʳo\F͖Q0V&0Ks7Q;@i}j74:f"̀RZ*&x,n:1@;j-!լ?jQ+ [!4zǩHQ.tB{> m^Jާp틞-+*М}pU0$z+ɳr :`6h qYFC(G|8 bNx8UCc^t{@b#씋zHt.Nχ Q2=ƴGُ  l56ddlvmNR/VƲ.NTcnsY:OHgykKd P4V }Դ5OYruzx*;8N(;I:h Z/5dKJ|m(?bk,:v&s*ERAM-h)AyZ38tJ``M6B <ƺ>`z jI]lUж_ХgplۏfPJ@sWy|nSO.QFI8.OъFہV;u MװGYPf<#v_׺-6'@nrl\rA4j:5<$}M,Y؏m˭pN(d&s /$tZY6vV6'^FRx,/:. 'KAU \ 2 C18sMbDj)urJ3<-r_|6sx݊)HMWL|r7=;gq:+_fha:x4K2!oSdH_MMyrOL6sv<H`Q֙}a_N m&9|B2N`3"뉀YΖL1MɅ8E`ê?/Yj>agݵVt"fԹl20 YU#U}sxunRk}0Ƹ|~_U:TNТS<!/惮F-ӪwS@~nT'B yfކrU:yq"::'Up.z8h%`?ZR&̢#S)q*Ԏ C\ pKtsoN޲9@V 㳬 "s0@$J ئs-AőAiHnsVC4l]oDHe'mODKJpNHSY^S䐈6mFHhJ삯Ϻǎ|Bb:b#ӘosK0rGQ1.LOmCN^L/񹣊NI%2ӟ|-ݾ"xԡם였Gڏ oB+(.>2=LupF(@"`Nl/ 15%NuHJ+˃Nn'Ҹ<*:#Nl@3&v0ψ0~~^\GCcZ_3&jum;дW;t}kSeia1wgI0ޕ(m5d5vf,szIyd=\9euF쬌>8&cmgi,`~}y:T>#gZF*ce='u}8 1]v\9+x6#CO`_o4סNY4ΙX&ٕuK$=_a:6P'R}qbjNDۙdOzW/74;~Z7}*P:p;9U߀< [ RPK\&AB7F.OEBPS/Text/The Treasure of the Lake_0015.xhtml}}ݒWr#5}=F PLQҰ=(r囍Uu07+M$ߗ 9c O/Ͽmu^<[vSĮLU^Loa ]7]Wb? ~ׯ<*n?ë]{S<[?ُq}uwwx S!<Ū-y>cceja?ݿb:ve cPwfv+ qY3C֥^|d?@9Ľ< 6(S7n|qٿSM}t_cg+~qfU 1Cn.ڻ>)96yXMB^4-F3^؈t-VkJ,Ͱ.vQWg~{?*YZ 0m H'&CeO7'mإ&N.:e_ƍcw&t)HoWw}DQ%J!{Pn?C-GhϋՓ|(tya^ޅcz}n<5qL cfuOynszpۢ^ܼgnxųgozp]Q6aS4?]W|!wI΋g05qcϋc#(4"[rj/Y*6QZ1IW=^Zvq Qož!b4i?e65q<؋n?y((Y"ԽVō]zYN?&]b?4'y\FR &vU]5rV6tA~mD\_A>E":t9MqV.Rht*onפwfʸ5FYwSUq:Oie2բxH>t8;bg^K q_{A56bD/(Ht{$YXc4W4z(| vRG ޞpm5DhۢK㪐 A~5$G@@&7 ۭǰ9[5l!X+uLSSd 6z}#UacdxSW6rH{6kyfW#z=0يr. dZYU>ȫK9ԍ%]eŬ6PYš*(@!JTh4jDD+CI[JT&'+ḚOﱼRIPIDxESۘ->]Z'SV 6""$BW %SX1h2\rvSK%Ur!/Bnp.PM,EL7!A/ٓjGQkEUD'F!&v*A丧fTQ葄Tԛmv5)&8XAHisR &SV}(Áٳz(q0pY52 * R7Ue9My(4B*E>|ݾOG=DC]H5*%vKbȃ<㱋Ǣ`jwՉTdd5njul Z4p3ܡ 㢸jVЩDr'G"!ZOBl\+ţI0X QZ->ˠ:'`N юL;^XTg`6"vjQރX=ݓm!ɘ!;=l[/C0p]`E(6-ԉ^z8SuofzQk@btGd;G@7n*MR?p!0.-ͤ+-̼ ii>ޖVrFT-vl[bѶf²R*G>NKT쨷5mFV@|K)Sxh㤣WM2,٧lD\ >0ÁئQ{Ʃ '1*R\PlDXKڏ?0zx"wVVD^*<?Rcӈ02Ûs&]]qkie?S4oJU d0# q$N cF%cj LRtz(;ôGE`qkGV_?+%{C6ab0n`*fm$x߇mhv1ʇj4g oiU12؝#!πQχ,9o# U 1z9"*)/plwB+^1,٘MU0Ԑ'3L(::i!R*Z)FYI o).@hlkY9l@jX,l}MA5/_ ߣJPrM'vn@%^)qhrE(⸐ʉxJv^ 4:t2xr8a&iLܜmC8B} rxt Dr\-kSp 9GhY4S *A+/9&vzdFx<"BmwMn M #7Y#C0’ҾrJTQB X9╹YfOsEzhBQS.;nZ:`,ը7$wg;7_t\(U#"Qr""::'8n(b_ofUH8åiwxȿdQ?0JeBGs`|ٜ@:4|"ԂE3Ԉ'()@p?Ɛ',:G"dbG. s>TbD7VnFM 3)#kYsͧ(NL"h:}SjAE4̀7-x؟%,K#aǾ]0\0 Dp ۓ%@vKAc䴚 45 *+^۔fZra7a?"evo7zk$>W62H(F!@JH}D`Wdh37/6=N7S D};$3^AJV-?7p$i"3"F ""' OIa\b#H\w0Yjg%@R#;$ c^.ʌ\6H5|`rUVQ?RNjĚuPlfzC4_C{d)\ezC~|-h$+۩اs_OuGxPh/^ GߛnhhKإ9%ӧugv(~n3VsxSRi,/nggBi5d+xND<@З ESoG :Eh1)`tk*Gm{6"H-k#ŷxIfKhMTh?Y2h7z"{tͅR?[C`͘dC>tQ7h ( ޚM5`I" FHAhjn.Cz(9 ِ}4ԑdP<Qwönu>9ٳBC܈# ]6?i ݈ "2e]Vtr\qm' 8w*vр+ZċJ7Y2:v0q (> SJ68e` |>X4\q/5#ll3r*Fi4H yC,hd}d [q.4w*dhalB:,aF6R@ >&Œ ZoKhVcq q5 #B507r >Z0yW Z.7$E^d\g!Bq|PkiF9.Lٝ*bWM'm=C".PvÃo r(w﨡G/e=F5^1!<ƀz5Q=vȂ'g7Ho#;yS/71#ߒ́*iIjџ/. cjrlGז!:կ<^}S/GKuv5sACo3~RhmA)ݦθj |$qEw]߁^-)ʉnhZBxb`>Y {j@<^ B\8;O5Y zO`10GɓK,@ȍ2ȉҁňIV{:Qb6J?ѫ((:vdyGL~G^8'3'O-*lAΉk/u@>A?vCL{R6I% V9rܢHt04@'=db0X|um>\]xcaDM HQͳo6!ͺ,smo+4C4jJ p+r#= 5cxSB? E!@%(gD\T?20B41RLZͦ@&1Td2>2j0fiiw4SЧѶ(; ݯƒGp.4)Vs0r! AN π&@?<h;Kݓ-ūFO"N,6QUzL43dO}ZatL@r4skngE?[z[JFDŒb+ۏهD WhMQ@ x-I힨.S# ϸ&@JH\$:}UgU ^‚¿Edj@y:]RC0=m7eS:vpJdC̤ ͺxӖNԃyЁu-E+J=g8킁UC@Ѐ:CNʮ&j",&a]~r{ei< &id\,h#'Q<9CO8GΐU"Ի]ǖ=DU9ӡ9LeY+>}-T9oH77D CNްsB @l!Ns \jgy[H&ZfXO92bs%݉4:ХP&|l9/Lҥ|-'&FſCddW[H z%FwtHיrc;߹Sw=cN#b ~(qdt s;_Y7 EԆ%)I2n~4}exO*~ _m-c5XU:af*XQܒr,F7 WK9?a,rR1}L8j-9PJ6<k+xX@.)x9(e^d(C\i9rT\.#AKɼ1l\('䓂3fR~сB:=H zlJQFNs-0+zH5׹h+ZR= CU(,/Ep3Hk՜Byyv5#G)ww@"?&8@jR e#Ȕʆ0t hYysz$Q5fIKnGzAe}ochj+¿a)TÍ0xjGߦfԔ!BY P x,OGy+]!ΗMMsL;]֯4lٗ8j@#ye)aid)s/R@Kx}.NISS@Y Ȍ@;<^ aUHf9h 0RNf-c 4{]q8!Y^%QJsLP!kU r~iZ0ػT3wwkaIWP{~xQ+'dφNˎ6`ǚ9@B92` Vb{5^gEsҤcZYb/2昛ۨ?P٤xM>lj\T(M_YBTucN l5 gx&_?|Xiy1<.Gk`0ˢDK"cZTh8@Ihhʃo֊岉v' *;+u3X*FzȄֵ:. echN ymEcFi;uC,l Zx'ՒE?/f8|,T,HO5+Q+JJA=d r5l3%L0p<"m=]Z15f&G %D czĞ YYj娡v-&mhVl$zV [YNFLhzT?bXU"WP< n{DQ4(դlA8\\b)= eVB>c媫VDMy0'}a;zo:@ڊnゟv37"p4s72z,ZRj~L]ҀSNAB%sYxY huo0;LԩUj6kEt9NDst+y&81cŞj,d%8w=mNuDϜU3gRi>z5) OH8R"U}!Eb3E]zN 4h)aÑ˘(-̺S}f"*}3aȹ* ~v,$jC@+p"H*y ̌pagQ}Κ%&#A)JR~*ԝ]ldxY9ZDt2,Ne9N+(&.H<=*K `zj\]]bٟ)4`.UV +\0DōT(\d֏Lt;8k3\:2|I'*A,1di{,_[sl`E/s|L{q/3Q1229.@j1)LeAG(hV"m~ iOVO~vNW1m?iK 41z.܎`2hXB;@0$4jzWB %MRAsFLҲTH6YR4چH%A"T*3)'fnT ׮Yi"6_^%K۞.@2!1LH!?>Խ= gq%kټOVW 5eFT,ŲEeJ;o(4IAl:p.6>4QUijjLm{ae]d9Zԧ,Z]d]$>:}<] g#)񛧭zA q<Җ'ɳG TtP;hKf/<6̤r2_t+fY (V30{68*s3<]N]@_Si.#eVَlFOwמS%N%Z[UJk}.M- }IVQCT̠""E8'*J- AQiL`-֜FŤ`a 4ՇWd5V4uen^pۀ !%疌Ѕ-1IjM7h e83_*46F+ɾ>˹ ]M5}{ʻ֒|UġL?G$d0˜ 4+R9,Q̽xs-=~A9ldM@pHL&4F)~?s3$i 2[߇C㤚^ vwb(>i.Ќ\ meĦ8SVFiaLS h E cN|E.ϳi"7 :f&i BzyC4M8'>KL^P,Rk|=GE @2#vpк`-@,[aOxbz Ӻq!fĖkU ;Ϛ)͸VhSpR)ZW!-rfT[VވclWP6gx*} p/:j k^‹$`SbnMX1rc cDn,h <Qɰ*jYԵ0Hp17oܶ|5DyAi̤P*YyL*Y6·ŘTQDCM4!}N9uUplSY'oTd* wdNCSVn-bd:;Ү-T&xZKl<DŽ oޱ*E^h \1XuA@Ө>Y/Hݎ>3Û-(P2uGkO%ErFدnu{V;#_vZ^^(؟vTL-m5Auh9H8݁eI`?Z[au-"BHx@">.} o:kc> Us#I}㨦J-hZjƁr2QЕQ{=+]s|YWVeW(/p;El2tv`Z;s7lgqL 43xҷCemY4;g.3tƘ~2{y34t& hF֛SajL{YpGA-Q(d6:Xe!.x4>8klQw9"C焆'sVj^ ϩfɵ' F~YKX0kMvqT) <8윤AТ~ ̩NԶii73T_fh>[E7;drcVK\:uqtB94=d.Ù k@!pP+d-QF= O%f ʹ`~Lj4u%JPde} =ڞ{Ia|4Of.2CybPCo/vj 2WGB F 2m-ֶWbmKS.vO:S,¹B^ DxDfS[dcq֊ {c2RW 'g.ch'8[VW:ԺpZ ^ﴵ=s  PJ dbZ6wCKzX3CI"J=6{\E2^i_*/CM*jI!5>l#=;ct Mo+4ʜn}X)=ٲI_qշY&kC`X]`jKGAq|cy0tJ'c`?e G4X4-y}E"\-RLIuI CNZ#(q52{wV8ted}Cv_[u*OkoiL2#{*4 F8ë{A@mմJ3Eq mCok=`s?5`80\Za#mر&Log*teo ls%4x^xҮoS35UMmĺ҉/9XC|/xʻ׶̑2B\ח]&򛑔%]|X/&z 4Yv 5 Lw9i-f/vPşmAs9mb /r"#d~WB<*{pue%;9Ւ*? 9ߗkc2/-~[p1L%GuZehsS?I0ںfbb[]\ۃ_ѸtLٳ %-uEKYEBD:V(S5̕GtaN)V^:Vwso6˰C}؄x-sQJU ZpZ[Pƹʜ/̴|f97t]ML5id-ң\7KyݢV4Kl#Г[eƹ[ȯ糠e6jہATB.a"{Ӑ0JiF9_٘5%Mp[a%mFhd]41쯺Ra=vjDP"*X ڝ-%OHfF)hSln2?ЋsI!YܝyDC~K[y@:\Evv.|0]gUsち}~۪_0~Z{aeW\eM7_|^xl|MWC_YZ~j}v7ڻ_S>Gr"FPK\&Ap 3.OEBPS/Text/The Treasure of the Lake_0016.xhtml}ےG?6C$M[t"E6n?ds#2glG*d/Ǐ_姦.C~zժ+C{v5_qtm߮nſ/{?~]T<bus{^~כoo_)U5_ooon8~LM9+榈ї~boW?ړwf57/? 7oOnCB{3q{F)o?\K/.K/]ѷ+C(Ož-c,.S櫯u/旬5rݰ*n6yڿiE/F7vVԊ,śg^Rp4qW]}~ϕrXB?msHgzuE? rS&Ymyvuw8mZ?^;wC3k;x]^}xo~՟?I?sEAV Wu|?Z7ϊQ~(t8m3^>QvܾOfe]E8˳Fi1oM?]y'/6}"߮^UoV/^Y!%-vEqˏw?u_w?>y~|!&=Ok;9ՋǛڏrw_FVNNB>[y`ŽؒPm7Vb6iӺ-{|z }L> n,Ьܣ-ZbQ_A.%Wr*Ÿ,֏˟~njG]mG_LǍU7*>\]QbLօX1EW.XZdSN딟a {;ЎI436Ev^_Tbaڴ.ʋ5XLrKCQz9BўI܈<ƒduaOȭn}d7.UڿPC]/ŭ1@}eƎa6< l 4PeעJ< hNx{kW<8vxUmWPΦ$9êDyw_ ~&4`%0Nr^Enm[O_V|/<4Fg<5,F8Ģ>ocP{XSpQɱc9~Ʒb)Qgi?-}_æ#yЉ |LL%1t4Z.ԍ8ZVjR/|ECC)~rZ8^/]/ͨoCQ?Dn0wæG-G6$z (B~}'يVG7D)?Sl"~J0 BD ?-^27r N%A`i}R>ρh q\(!Ha]%2HÅTUۧƪC#p4z!mZA7-ts(JEc/hS'-}ߤ ^}6ّwEOwK}Ð|$Y xQoЙ*Ԥ[UwпV" esP@١<+~ W>GN="MlO 'G"^gD< E8pFvl5x`*NF dk<#N֏GwvXC $' };ձr-g/bMh o\\+á@3!(³|0pB?}x;{iKxALNfzSU_va^V?uz]kx@k]| pdt|v>WfXS No^d>SREQ6\I}iXu!ӓgVu^Sl̗ƒNװ}(*ɋ\>qlƏ?2\ٻbb2 :!#DGO`ſD6!;}؋MJAΡ]Qll9m>AU7EAś"I>bǂ[c: $nO OԶ@$fC5׮ c;l%\J1(|hrrAv1+Uf%A`WB-K/͹U sdqJt%YwY|f"E3N1t8Ҝy]S^(,'7AŠQRÎJ#'vgD|_J{ 31}HINE93[y'Q{5<>z%Nso4pM `oܥܕnw;@ @IlQ<讱e C+fݱi\/ _t7fjOsB(e.<1cN<׾pvV+CJ[i-cWdԞ$ {/Eоm a[ :#-9 H ooEpDԒR,XE? B cEBNr= @xpS *`66wtuAc-mЂC01Vօ)@V,%_fv_hruJi$_yvN\PR;TmG ` "a˻~Lj>R[4K?V6V׏h-Vۊ blb i\SPզG+'@rsjpO-n240x[$2hd+ JO"j5Jd2T@ K!r<†!h2I96ES 422ELfh2ۮ))ǥͯ6S 2B_7%FOQ3KBt-T"YZs ͢pD&@nLp!(>fv4'[^긻~ӂGw2%C&\!UoQ]bO.UK+!r?ۍQhBq'xmf+w|ѫ@\3 \B87B$gʐi;359-f IS"D%eDԵz]BMl4Rn/SZfӶ ) PDBqhOcve4! `&L=( b"y@k ]=ccHp)R]LĎbJEAAX@BCMNbuAҨ!>Qpa&oeA%gX2Ibs"/}(k20G%{hR~5388|Mbk&!~.TNto|Y1ZI7r)ļ N=8v͹SbגjOH_" @x"e.vS~wUyr-^ŽiN=C*AN>^ێ?VԒ ;JM"L$+)jSnZY}Pȃs1L1w[f9S͂yH&jf?] D$N0Dcj6]=/Jv^bX"m?T6xy_Kܗ2VPM1 (u^8MnAğӒ(iIFyW{2q4Rվ] -kRQHfI;L zW(`@(t'DKG{- SZ2qEzt@3wJzc-^s_5yWqc-X59_eQ861 E+Xh26!LMQzZ-(>UeظC~=?XvYC <&q,epH!>`+vTp^ =.?9QQ"c2֠<HFf!b^RTrx;X .&6B;Q`P9dB4IYMCaIWty3)0L"=Fnn!JsZ.S mX{LH_^'WW?I"(d5]3 g”~3&|#-a/怗\:|@ug͸*!!K1XB/G.DLdX l&FՇBs/g4Z;|s~X>/6˨oDZ/ S] KNji +inr\pxKB&X9R~› Jg"8i@Y `xygVT(' BJ7ʼTAJ2I0^X D@K~ȴpP]f۰d/s-o9} ӥ8 CfT 8vHޞ4]=oJlJR{AhNyRla4F g ,{-C]TJ1wlӀh6WQ Kҧ%1ǷF)2 sZ5&o=?ٷn[k-=#,Ѳad$AT݂!Z`kG;d@5{KhI`gB=9`+t]abq pcpSLu˃OB>~K1:l׳`]yv`䆙g$Ns*ǩnIar_+LF13H0̊HjpEvjhՔ*pT(}ULU=߹lTc7`K@kGLN̎{cgA(TE`Pm YkUZXp27'{25 B/,ϩf!c\dDk\ZW^UbGIjQ©fx `~^y|v1 $W4r۠ t hFo$/ YM :=q!~Lj$+x"Osw:XkF5^6Y۠?N2P_vUs"vR (F!\lTN"<9>-XV/Yy4oH9P(6÷WG F^9e٠ګ`iT-sThةJbUt:XZRTmܰg "In`W*)  kאg UV-Kg$4$q(5l%rǤbX%3*1 Z#];Vx+Q5>D;C\jر$$+%)Ys  K@V0iY2%${'3k3;@)$gq{A6> %K7<>VHR^$6%V--hb\A(KL M$; KNt6i c-Nr}jx[hg s߀V3i'JZЁ>c~_dcM5ZΑcJ`QcYz\- yp{*%^e+YwOl9s< x]}9lu7jPNv /IXL͵b( "M .r@M >IN::Ӥnh=?"iʏ+>Yr+J7Ր?9Rq l.4 `'r Ԕ>/M:L&q=',Q1QI=dIi\'n`؏cm&@P?4]k/!'fѬ:i;Nў,R<8vtƉX ?WYa٫D"hO E2܃[ѬP"d'bOM°KLPX1@Xiξ6LU3j[kw4Qʅ!Xj[jL͚Xc O h2\ل ^]?a6MnXdyV,[}`J8f(5,MEZ }آSZi9,8gF)GʇGN,V=]'xUyAe>CQ@Wgjdz=OY@O͏K-l0c4ֲY/iI͸c*o>h8t 25nܪˢhơu pF-Qљ869̳lkZ&<}'6H}=\u gK FvM̄q;)jBGlZs"Ǟ91]yECϹ#qUj0f$O.8y42$( IRvt4*'xGiuO0WOȎ95Aa;㿩4Dp>ڙMU<4d7>[c\q W`9m@s\d: i >r XAZ.o`#ٸ]aة-vaɵVtC2# 98-֒X:t,G2rȷr~NΝ{Ӓjj-Ii;ZeAn]R- ^b]W5KJ6ʑ,\ԃH1um곚8,dܝ;Z6LZ]i2\K3`E9ҩ8SD64&ʝ8pN ~ZըB}7:=g^k3߭jU ZL$)btg:/Xc8nK0>M#,H4d|cMa79 Lb.;|0TXf8t#*8c,md:E )09}]pqzKsk;nmJˮzleYצ\d8KY- dy0.؍ K.ZzJkr8Y;0b>&qNkԳ{Q䆬^K,=ÒPyd ry@NoiI=WrZ8B۹ UQf]-13=SDӪL`N.GЕ N4'OT3\"isi%Fot=K.n|2ƳUiBY-|%EkΪ@܏ ț[/=a [͹Bˀ"3)c]  2Vh>Jमń7DD:Asŏ/+f լIL,rq7O 0w*|}".C\r]KŁf$MՌ(>޴,[6E-`y#3.(t-_yvzI ./A$(ԟLeӯZy3.zTpO΃}Lꌲs(_~~֢$WJ.)l-exf&rP*qNniɸbK+Si"Z{B){6in[9#6.fR%p6PLiAHs:Qq-ܕVQ  #첻,_jjyL'SOR3ҥ8ԣF/zSB!{eݼf`{'Lz!_|㽶![GRq֐X<>؄ح%?r|*: l_ԲҚ6xr>V15+SU6\]l3;O]F ~&)}Vв,`QhIRMh54l-qG76gt JIr'J&ՕvnФh8 cL, 䎵zT',JåEh3Ýl0Jŀ$}m=Z9>JhA*fh"gh؄J΢!hTP>jZL3$1—kך~t84 yepV ˶1KS%&y_w9ILw:8D3cv9~ʣ ṷ̌^H0yX}mFDy(KHgP36:z*Pׇ<5Ev)/cCɌހsD!6&MkMۮQv56|OԹ\[TZp쪘 d%Q`9*LO2/PqlmtjsϵJSKhp| !L2~%fsNAB]\ۨꬽr<cU)4Umw<2.Ͳ%Ud2 i ]aNg3@Ar>ekcB9Mү}{7#2E!hiހVԁ@tr>-W%n#<3.)eNl+a+R뫺;|z7O+Ʃ쪲]߽/7q|ŋ~ŋ_?ou/^(t/wpx? Ŀ[|JU_?7Ґa׷_v(ˋ?UޖC9T/\Nih˺{wyH퇯Y;֥??rG{g'mbwSO8uu)PTwU_c_|l,~GͦS*]jRrꇻfIF~L>yhDZMKf|}}G^eK!mS$fiHr=^0hCǮoK LnOÃSwsyH&c_ᇯ~_xDQEٕUy>zlO/ՓvkM_ۧp3{,CzҤfmCj>c:O=kJ?O/<.m_]g8[էw_ǿ싷->'!2ʮ5hhlƎo7o_'/썿+]oGƖ'a4 g[ϱs*lχC(d϶Ms)Xtt4]Wl穰o~*rX>N >0~>|*O<ͮ_ES-c;bU]AL=lɔ>Mw<닶_6vSV 噯vn"$gf@F#X#oy Q7h sPӋJX[V|ύ”7EyNY=X=mIJaydmS7 Fn}L9<_ $&Ls4幔lkONZL B?K6&Iq>`'ً;%C_KY)u6Ǝ"lLj4L_V픪RYkW8re ML|PjL'SC)YXoZVg|۷1A?#fƛ~/dh'e ilim${'ٛɆm"s}4jm&AkMp[h7k~l4D ÚJhU[.ٶ $RISClq Qms|r9M%{gCiم7gCv5 50jmiJ`eh<6Gӄm/A}650y t̀tS= _w"AlG}XmF޾@ Ɂ&?ey*|O>m3KŒd ap,C}8CP'wbLe[|iR+#d>=u*k0GnjT;1/G)uZb;ވ*ZENRxZn ' WwS>Y_vhYa#Lgf3ٛ7nIwv;Ěpv}c_ f/2r^4˥^?~י6#D(7MT96U5#d(sp[J30 iLGҬ" 2|QB(Hٺ^uF(N N y~D4xEoc֡@ >v 3%0/y̟y_keHl94;Cvh]Нä}b!ϱL83\"mq+@xό\K?ڏ,0X!,iʐ͉|gˆ}=D](rFa, Lm$==@rdhTp$WƇ爆(ATsMu__r|k0Ak $jJ!g^֚͹dK9TBxus2E^RM:α7fG`ڟiv-*h6Bɂ}i/3$t`c2;WG`ZFe${'9()Z'X4[Nz$d++@[IOtTU=2 (ov`dOИ>g&2cjaWqD7n X'vbSdO ST-_֒i.W> :L0J}Poj4]x74h;k/@7ҩn7!R=X@xT[S="L|9p&o AxlI͙K^1獻94Hqc G rbGętrV՘;M/@﯏W5C[=o**m~ <̻ZT kjy.Ԭ RXu0#2!ByĩMU<5|x_ nǠ~Q֣`8o})RH0kVwJ 2M}L&TWni˿cOc8wU8z9)|so(jztzNYܕ'!Νp&份3N#t)S&t[g2^0sbAրJzcLs%?$f[̗D*b)Jg-h߇?T6|&sHWK ۏ/h9ǣ9ο`J`jM̜2|N (4!_dJz"ȏT:p3^P]Aں6'01OL(A2bq2|&ܴ[tpתߦɅܑ?@w1 o5iCL/ L_iX+ NOh3wq+馵V@9䠽πYFd"p$evJ o>eڃH/ʺi7<&.֘3l"Q7dZk!ϕ4x튓}wyE{OĽu ҥ6a2(i@ O`%X3 #o/) AspG QߤV*jh2RhhUi@6JZvEl υbC x1A52Zx?a5Pw4|i4y檖MW8Kl7#dE\/ϵjO¾, 6Y<tV$y~14+C|#N0S\WE6*7Cj+db+i8(!0$2o2zg6mk6!2(? *3JCrL=#b^x"0вvD3=ddȆ:aޭ aʈ828l!r÷?ie@oW3T:J[(` bE/'8QYAfIAdRVص\a[r&9.A$fKDe`$], S;cW, ۅXo&@=ƥ0>QIHn[ty|מ\D\}, u㼚92+?%*7CCJtE{'Yt ˈ5lҸ yDzWް⒂JΈ $pV$lkD"b[=3T= u`Xà& ivj)nZBp!eds^,.O管 E-<~=B7%_ubRX-7lnUoȮ5`6 &FNٴ@yW'|TxCqIy^`ؑWr1NfKӁcU p^@*u߂2V~a[K{V?( z.[΃rUa0^p1A%`{`ʦ JctaߔLsQ]R:O0&.]lQMNDtԡAoY%jjςΔ***b"µfUMpy[tO&%%D 6ZgOO]Hq%V~\&S2O:Z=ÔvD.Jldn>wHR"S `r&aHOͧZ/dh EJj*;'Jn-M)Jow{5A}O\h* o0Qհ=ݖbB@iĒtK,\J-W֩6>%ZA%j҈7u D4b@&CbE%͹fIԞD d:e,KMαy-ɳ Z'V^`ze=z l&A:ZG=r誼Wof*C^+:rw=v*O9+޲Zd`\g[ZmTO,/AzJ}=dJ!r=m{Y4]ޣc㒣4{#9#<P@{0'Y oV0(lԂ繹AjՠO$J^6< Zӷ"X^n1yI͵mnx5v!q՟DVr͢mXBPn|4stzs3CFG6|=) 7Bʀ#X,(Qp4؁8]&W VP"B2Uuc dd exv&4@jAgs$UeJ.䆔tl`DЉYureOZzԫZ@Tz"oİλiEA6tp)]P!@/o5ixv }>NLb+??Yb:H#aɔɫ=K?E_vL!f^' Av)TxtQR:VM6/Cقnwl=Emo+V=.Din_pﵒW $z|1d:#(H sX/WP3ӭΟ==Sur~ A+W "rpTsV[`d; P.<+y4|2Z&y9>baM_R?KPVRkןvarm^j- l ODQ7A 4_ PM/4ZIPG8=]G}-ߣ`bCvyp U4\ eDau(+DxI8n񧓟DE%}eģG@`-d&fA#!܋8ѽRl_r- 2 URosfE3h8r  wCPE\M#27Q?;;MXٶsW{zB?[0S`Șԯ9'Eŕz=1#J|޹D _0Kٟݟc=F;^%ٛut?ι5Γd/k~f:WiUԷbX蝡lFcv)9ԝWE_d'i&NKeT3濴e& 57Ge$v8JFyHVK͎ml6U9=jWDϼi.=0J唚ʑX80G&XoҜ 6=[K{)1SI[mo~,we=)DQJƞ?"cl9LX]2GOH+-0Bv:UJDTˮڇUk̙uWr.= DpD[t8 0q$ ["4@1@sf navA;!dK0LL{9Flg˚ʹ#|+ӱǰfU3u nW U#\?ċ)m3]sZ@93i$W_|7˦x:2l9ᱦSŇdu@Yрo̳:{FGa䯎ox6GUfq-@+)wG9zNr's)e##ÕښSjpey^l 1$K뱹Za,.@4 -:ȼ} -m&u$kBޣT7~Qx_2}#O܋ sqOTGW@>~s=s4cIآɕ W7xӥ_QM賿E2i<{Bɝ u#䇬%}0NKlVIG. $A-#QeQG?g7 ʎ#s+~UCm]Өj,E@3Nc9~зTb 5Q6ep&SuݰSҭSt7L,-KV%cK?kGb 3F 񵢁j„tŰSX[6m+[%3' pHNt^%/lz&~U|gv4Ϻ<=p,-zT9+ke[!䒜 lsjxCG-HmN=/\% Zfn`{nWR<&\/+82al,Ud-D70"Mlzp Gs/ccFc9o V_.w]()g:U?3dcdPƝW''Zv} 0lQ%7opMWԺ[cn#OA>Kp`Pwѯ`L0+zμ xׅjWl[2:ּŶy% { FBuaP@Bt= '* /U0nMI46@ |Z#g'pE=P&azH˗N(\O~_Uyj/kGf!Zd=1U/$&'E \e:*ܩ*5QkKP5'DBfxC!ܒ r2hAd=Vq\pqgP/a؍cR婮`HORCFJ|Sh}r=Z]@>Ҹu0cߖ Cr!ٰpIʻyK ׇtWu=g L F=ic #Lqbe0 ѭ-st}6Jy^-!g#E/_J /1a/3u޶HP9H|U4sQ -%W+ס2(:܄ڜK//ʬPWߐ|K喽E}Յ|>܍WZguAIXEQǎW_HžM3k'Ǩ?~ RѠg'm4KI?jg>>3?gXx\U'b<KK\^Vk"ILž 5(-z[:8(X}PhFrvbY=kGtԒGe>CenvxpGFh(:EZ\r+g]7q;pJCU%]s/[c$b6Oe"b$/^s n jжC(/[Hݓ?GCƊ_W6ӧs6zbMrs 6'Y|i^F=ose! '6)? uXUI]iܨq#@<qM*Chg t;(Õ-D[)qd^PWeU꫎4DSW//l"eUg|+9Õyvڌ~ $?JU=PK_+mF膣8.j]U2#9C<)JtЦ&W$ToN_ZU?E.S;gžuqѯ\woŒ\֯6,`I ~¦_]HxkB[N;)T{2[W#JrQcnCs[1w6q_fDʧBURx_ Zq_~Oa KWH܅ڻ%wcE _wH"@$W~Ծ +ÿ+GWчgmĕnr)ίls4}:m'zDžcLP;O>Yr z(䊩fK=\CW''?:}.P@awbJzUQJ6+,yu&i7Oj{ѩQu)&{1:[h`Hs??_wͶ7&-;n6K Z< l7>&ߛ"@p |7g=p"4G PI{7#PոBѬWZ'a{1:*(t+k ,2O]w5MSx̗oo8"nW*2yhFd\;ԟBANV~7 )0g0MލY$ֶ\C1A K3#{sqXv.r֎C4:/u)%Rrm-7h,f&h*>K[GՋVBWzLh@)ckDq-?Z< 38L= }e8򒩙p ,;0<ؒ@E#E㇁׾>@A׶R^@ojrN:cF_{|e\7lh߆1}& luX~,Dw$/{uvkn3^}D6aZ{oW~ ŀl+ 7,jqC>/\S4T;/,.dєѰ'c:y-K.u(y2u{Xy1\B_vq Ʀ~UX1p4Pcv$7x=ƭ9™Oa-*h|KpȺOvs'u{Ncy_*;ӻZ/?=]13۾ǩmPK\&A>_-/o.OEBPS/Text/The Treasure of the Lake_0018.xhtml}ےG?6C$mzHC԰%Q#Okd32 # Kq5XddQOl!V_oZe[MWECWw_=Wo_/j~?޽,V7O?_o}(V8t:mN_o?b3M9+H!~bWmC&LXo0oZqx0>1mU|/ϤioÏ>ny?\'g(XauO8bwcV\<~(>]ٟR⇸&gW_"X/Y]hEڇ!*n97yXM|&/|E/F+yzjF*ul%I _oۯ|՟+Eq6.Ia=ݞ0lCoyb 8v4;LE{wU'^O6?}ό Q=t^.z>Tc/vj?B{|R(䗲KCi[܍s{= w;}Q qj}7n.l|Jm!|q0[Si/:fJX}Swճo^"~|.bׄ$(͋Wo?&_FQj감д}R\ɎbSe(xQ@i<ݍNSS)n",؇FvujT6h0%* v6!N5=/b_q!6ꎎB7Ĝ114 ee4 rfkRm\suu ^M 7%v4>yFv#A{@WME' @dbG8!fs V׌=p4 ЍT-ݗL2vcQT'} 8QDz1ܯe_SwhE)6 ֙@߰nͩ)aXSeG٩OB8uH+K L%YA"`Dث~TL.}F d8k=އI]X=7bu)j  oܲ HPB^+Kw+amDŃ?N܈Y /tN\|긇I+_IJ_ѳj4XPF lKNgmw8>JR]%lm*!-݊Wu2P7{}(>T a|ưߊo" 6sq0H K.T0u Ŧd3ԁVlSXT$b06'z>fԪCx y0M\h0(!@D8F)=F j!'Xn1e1@[ 5:k6MO@"F#B_ ǐYml>-E Dpu'Pa˰AHԖcB`"8RN;6&gK~*dfLxVT'9=ʾ8;(6Z6Rn aNd1a %5s*dKmjrc )CaBQl}`^}J,X%a`Xeַ%lFn` EyDP:( }iNBzϑn#;9Ӥc=Tߴ=W?b\-" {* ql r=&M%MO1ri1{ >"h:ZI/8.j 6 P']R< z0(Z51M L}MU1M5+6B"Rh?DHOΡ`>Rk9 :XhP2rc 6ڱ0[N-NMjYe8rT }hDɺ= |R(@C_f۟ TE*.B@q ^vJECZ<M~O%VmE{f 㴈 `q*m :S9ۑlђ4D!إqR.c(R 1'.Ly[0a*IyIuXvbd_w?'EA/igLȿVì0g2իZq=WT&`!ؑ~8"x@=uYP[Q-+'Adw-!%{HЈZ"Tڀ@p\~CgKC~Ac^S>*#)dzG$l[}yaki)6q?A`xRA*C4$jl"n`5}iC?f2l5U"UǘUs=(Ɠr-8ƨʯzngdHA{ST磘F?VNhse9;RnN^B*D;0$; Z Ks|Vؕ~@L|ѩgNmˆ&Ȟ}W-p.8 q0c:-s 鑉9s7|R?(HhAG43(1SZh 8B#X12(&BV:$A Q<4b)gO㜊 E5HVͨ `zGu:QUU9TwZ"a:!ODG=DQ\NVwA\,Ś[-#<yr0*܊/k$(!&9 Ob8'4:1]j| -ӋS(o2w9<Í`Mnt8EzM'I&~97Q*$8~7[bt|EW^%U״MFE\R3ssP 1ԊEcUu.j[N`d"ZG:r}3sxէ@ctR< `X40BEQx$dbb*bQ8%Fr4o**!ʥM#l-$}4~)B/s@k&صK_`hhNv{1soq9b_WWnT8"OhT*bS`Ef4_{@c-N7\J;91 cNgƢ'* S/^ߦ2jM}L #-I"(e͔9}r:p`s5b@˃<7.g ѮQ{suГzΕVz5 lM\@RC^%u3"o 껔[z"ğ .< 8p|$IyȂG3XG) ;v%XfF *{,d3{R9l I̍i7aէ3~[u)jz" *K-Oc>J;G :>;g,z.4t0v s,Iˉ悼5 CۄtTA}8KeKV9 OTWSde10'YEV<}3iԓe6bXYH1/s5̓a F5Fi6%5|J8+٘~2o!~`T`ɂj^nI?' 0u`0\M"jr1̾kX0)r%L/[ 4AVfPQGGZR˼D^%)hT7 AZ,f5%908M"BO SY{As`t^WvWb#ާ QDE40WKp8$Њ΢8bM2al\UҌr̒<{+fd%auڝvT)8Y.N1:K ||<)~"5p̅ kAOqa%HԔlSM=׽~NZҭ |3j1g9DfP =urN aSU8eJҪfLA0YM |Y<>#Cɓ,qWǬA)4guJhATecA2T< .2faсVM!p}iQD&|rtlNRz]%,I=𿃤$M--(^P)f ƵhШ(Q38(?OCS\ckDʨ|eNs ,hFb2&; ~ xeQx%Ѱo."6%fV5ч*~.q:ySX碔2IE)2]fx^q1szsSb}-ذ+5EssnZL,-ʉ~&e dZMM/Gr +)<َE av[AXDȇt qR*> NQ0WszDWu#WN*g¬V0]z9.PB.'hLc9'gGNd|xb;w~>4Po C;E )T<% eFCWD) m7+0xhkU͆LzJ )L?NEъ~<K`#W%gFSK@{BY b֐DyjRBx mh5;fJG~ PbnWY1rL:\ih_3sԥz֒Ȁ0ģ+}17E7ů.6&Hf KL EkilMhOVz5ZmƠ^O]F]5.t:93QhދO+Mx>Bu2BR|sR`(ٮjuiv:5ES4sX( +ӎg]d{X=Vl6=I811="4:큍$ܟLaR g#jN5{e-ԣl'c$ϤJDv41lD_ !S؃q30bpf.:rmASz /)>X}0;kmwm4:h̡D[#sAukf@걝׽$ҫ |!Z޴ Њɵ- )RXv Q^p%o{pk ;a4*תT8mR創A;2UWgY`(la6#+>wYA)fD]{ީnUMgj6^QoU{L]eAr-BRݗʙ\ʵCG/ z,=u=# l>? S/Ovj . "kʙ'I5R, I0ÛFW o)s T4dOCgd<0Z`H6h8j!IS˫>4b%IW`L /{n~zY51Xdkн/Ka Z֬( cYabV.Bqzj?Zc ů^uqЇ<ZY7)`n66;ڻj3XP]TjËn5~R>/0ÔmYm_:-K(%YJ-YQzJW. >LN5^>'F,h`lv=zE^@z9={|ؽDҞbk䒴~!DQ˙ph0! o4` .ucyeC.H a~ٻ*_g9C_M|v 1âWq$eX"[%F8::._&m^iϼR] xBMnE q8,v玥Ui nUJv̋RdX\QZ">ࢇ^gV*^ߐ_׼vk֝i7L1pCGL2QB.'re: k +AAHc\%!Pe.K+q:/H1xL ķQl4 )t(PuGG Ektr&8=/^[qp]Ysp@M\Y66jV!wgl}:Q!Jj02Mr6kE%m>ȷ G[& h#KĹarQdK/ER@{,U^`u (MN+4׳/T#|,r].o^@U{6W*Ʀky׎WXf6- ϜG\K5r|Za]a}l'T .}`Ys#Ly\V2E\nl$4Qo3{ec!/1@rz'A̼CgVm1o[/K˚f5={u;SjGKt؍8Ǻx-rh\@TRngUW7 m$ƅd6%"O&@VU^zPgԸ2kՃvxk`0/kwDǺRg&F1u8/.:[ stSQ~:EnmrUo 0+T"Wx dp:$.Y\Z!ߚ?I@L~uɲ"s1ʸˋt}٩\2|J]CS\-ן4\)ڞjxUkϜ^LnJo&c_@G a56 R_ף- w뺖Fψ߳ 뇼8[w7?%?ЕH\MBgN#&R כ!Y4)ݲn(J[Ү>bH7_?5bce۞+kŚmC]kzv.if~QUKJ. {\2qQ?&@e2?޷7US*z%^xzT볟*FT`i=x,, ú]8Z[=g"ipdj\_ mQq~h- ,Xhp19F[Tw\A-68o+cw{5k"ޣKhcWDߠZM"Z͗.F^N@Y{ (C8|~j~lHmS^?pieN^b4iQ~)6]]|2'->jZ2[L׆xy؍NfaH-gEa|CYU}e/㗚DHj))D[pH y*ᕖvdoJi{SmK@}2)-֖#oy'#'~j-If0PJJ[ͨ?z~,tk 'l gg`x9u(TB=[G]*R@rUaǿuzt;9vU?u3}[WOoPK\&A0\W-m.OEBPS/Text/The Treasure of the Lake_0019.xhtml}}ےG?da%PmzHQSMQbmSe- +3|||9@c g?|j!ՓͷweB~5Ϳat]W]\~|~{YGY/zq{/''/]?j?=N?mb}VxITcSnn}U}looJu}])cqu?߾z*߿r5 /޿/݃-nnTE fO?FŽ<9YGW}7~ۿչc_|]OC5D]6 A)ލi }ZYpbG ~/8e\ut(-vz,voBt[jG]C//5}߮eKաkO@\bZ|Q 01mN(>EVT  m-y˟$}uA<ҧ0|kE?:? t1;@e[yEѵomnR%zηFh XNXP 8oj]0Eh `J;LPa 2l,yؑY\_@Ch{oz< 1gǓ|nvh:*^kAxu D\c_vU(8>nEI[<"'gAwvY4xNb'ڈV򿾑W=֢؝n'pmqR{jk(N]Oj2p` xr3{ Љ(x/'⤶e=ҕkE~|ܸא_8 N4ٚ Dg+/xh܈5H=0؋m=e"N$70j}4FK'sivO!TJ JFGePTTe`Ǔ@p DS#µA܅zwrU+69|JBv6}r_7ǢlL~^X׎߅:,,[g#o  m95Sڢ##41KX$f$P{*U d؏:nV1ܬ CJy8ibƝp5]!ug&/T Cl~pJI ax0KFII?Ā#,[e$P [gxxI>$P7=Xy ޠn8,N~uXQ9C<ĭX8䋣W,zUZ&VEȆ$bqM?ۻU28<7TV|E$*]h9ۆ,]Ge xHħ::E"p0.kUvDu5LlaEVmu&FC-rc?ɾcCnqXL'%z85bHوJYCA)+AR'Z4[ @?DUi.]&=aD/K"Â; |0y%G'<͒֊mumU!lyHs DS ^^0wc00lHt~Jq3ĥU@bΏE%K G*ܞ+1ݵ竈D78x8˯*hP P2! Dr²Do &'q#[Rlk ]Cr^U5ʊ;P+9duk *kH*_Ԅ8~NЕqd*pX׬RWUH^GQJ[]A0Eu?Kn2%tMɓyfAڅc5+\$bLL.C*<['d-"䣐GN&9_[UF]fҒ  ~DZ$BENɕY؞eyɀ<1xP/0l(QP]7̱o_*Ujl xV쬠wC3; f6+ȑEw >leW}:nS܆8Ki+}T9II+ E-/^t MJ6 @J`=29BNA}=xõ8w)d114Ҫνk `,~?H8 țPz]]/pVWfl[${|nb'0i,u< v")YaiѽA1tyRFRZl~B% R*& i)a5ǖP7P* od2m",%V] 3# 8R5vgJ( aꁛp+'IeB `*,1'_V!4)|ݎ+ 2ET 8ŜGycWj/s7j_' YMAI4M|}y|۠Oʝaj97H< ͊k(ګ*=qEZKQ5#r5BHKA4xg0y\2bAT!%p&yk$ 9YY兡b~!5K:ylZ 9!LC>2>7Wk>}b9R*F@|;&AAI55eA `>ahYTzIu>=z$p$nF;#ِPGW/[Pܪ ~)YM##x.͑I!06G#WT" ʾ4qz k4Q,k.xOLAFנ`7Ňs,y=#=]fD{&-(YjaM|Wf\'A~4gMxie?Ԙկ1u-L{2Bcs"R-^6xEt (krl`UuăW2 A ]-Y<qIr>HRi'' B;{}RhIt_ĔtƼ;>wMR111zX4(wOzQjBjhn驀Ӳ33gI;%IizUG"C-H*+Ǻ'xC v)B/ĠkB+X i2DțQȐe3]&/&xGP#x2Jo2uE۠3Y-K fտ(pIůTj*q!TnZQC4KE]hxBnRkv>g_dMTᜁ&5GpͲТg:ҺDRRJ:ăfMaoY"CM]UҖ|+p&`}n0`8sV6ZXyj3ܑa|a4 yU]o/v e1CQṴ7,P~-Y5ڥr)joY#wYPN 'E ֏(7k di3a_Yf C.knE5Π 1KeIu"02I)AEyы>'{$ݢH2џ}(я). Pei|@gODAgQ%bf1أ}b!AY˅NG#owU‡]l '+.ց°|mDL۔͒ILlkk拚C'PEʳjHQՈ ?Kr]e JYQu;VLY\ g얒9T>XsԬZV[sK@,wV\7W8oڞ5\lʍr*=LF#W7\r@)]7}/CUit"A%;aF{RZ<Q,| r#LhTQ`7U1c[@K@jcwo27pB _5/imN D2dJΒZ[cmӒ~V$ǶݙNߠCڲP_E=u)k*CWܒ m:bl1P&`Vݚ:t/'$D?G'`Ej8NXr>q,~R{3ݑ!3uIbĠcfvy$(& Qjl"nչP1[2i7{kspZ{ن.*M'j@Q726z,}3INjS P4UٕXcFYL\w/ Ks0?E|h1S^dj+t+,/7?V~B`T{tU^fVd."nNYH\j} nbPtCn};*jB˭shx")o.YSGVl{;5=3NPFֺ$n G[zUv[3 I8*Z.U鸮^35Ua3C꯳uI Z=$$G nя gWۡPmUsof1o|4̪m99(h(ډ`:{lnH8x诳:&#Pt51->fZp~FDZ>bntC+-M*^2,svhd7ދRa@m(}+UEEؤM{7bzcG_gMヵ \j [hi7n#SYwn֥1$Ðm<d߬$=l2 \њA$ (#+OW_8LQ@bۅWJTFP(fCՆyӇ!G~F‘koDIj/=ʹcd:D#m ܾƛ_־-ۆI`n(8g7E|"dr 킄Uо\,t zJ0IV'w]*fT}W,ງ5] :?9y-y;A8zVFC& RBA_>Q{^vUd]/=Mt %K3jVhJL}0~^R|1.0Y)X^Qc rݵPZtH9[+;JdAC+PJ;$SL/`5z`sh'SpavĎ<,ERKIA@^IV;;(ٱ 0w0AL Pc>+Y ;HRDxn\ EUCkdg)A΍='\bI롻\^ %q9u54M\j8x tUC WXklaC,CNi/˗)m9YxzwJ:K@=;9T,bovĄ)cDVȐXn08‡0i]B#cdqϼ{S5g4 #&gJ7tu3y$o\'=yKb'3Ěs%mb&6xzmI@SDzj̶7Hq)M&\0jjem1`@:M5pe6::?"2_X.R?,cyBu U߹FB .Beabx5?]XӔɂ}aE/bFs1zNs.X7ZlH5i*0!?%%6.xWy0aIH+P\.F g2qv5-/=5RC!C~R.wv^z,rGW`d}zKIʻ+yG <SRՁmvuSWц&/ n6TJHb?F%v64g#H%gF t:%rLrȱZC tv2%W%ϳF@ܦxzIUN0G"MBLmrKN]xiuз 6gLpmLI%)8N6)9gP 8lcਔn ]\}w"x}5 dc?:buyOH|%e%a @B\t3pcz /O* nQ aB*:hql>|vud 'Owb}Q$ Ai %p탁nW3E1 G U *6t]}'y6FB3lyr} ԕiIDa% vcA=^<UD\9)l%MbYcAF4mpfz|6\> bހ).X't%ç&l% z5%)c9D{]4PqcY'qgZZ8i)\p"^mioxFDJeΐ5>;_G1X?M2PKjp&-|k5j4z8c [q9)QQπQ\r`Ϝ9(X0ĭ*%#SKĖ.6d9[Y{W[A>˩dȾT0}Iq8Lu=\`mH|F4%kַ ի y@B̳Z}H5[ hQ _L/=;;8p-9 >a>]X159t9Z#|^}A.L~+'v0OIPm$m=PoB[N`ԻI6s4W|b^m> W5Lth 'b 7jJ1\PGA)` i4Ȕ9a%OП~55([NG\IZyN+V1ܢ.]gI< PĀ{&("Jb"]Ofll4 !v|ämUJv -'7vi:ȩc ټE46B.#vVVS򻎉.i-PB1N+n Kb=9a?-.spI)S,B N6:;7+96"鰪R܉;O'm*pe,f.3ՉÅ?q,vΆ?Na#q尿60OFCdkRBKŹ(#J/\ ~q3'\L(MUvBp0hl~Iݕ |F=Q:r4?8;&.咺ADĢy (G{鶪qie Z=fOz)-/a9!\ 96ކ4r/9sBKcIw + ٝNA.gJKEP.ӋkuD6leC-oYMqK,hHBNfCEvxچubPh-_\#Y1uv)vA3̘]`9HJ? ,IJ3Q24ok39ZQ_bF+F 3;\G"gMY 빐ZCm*bٰ,o>1rSnsO ml7k+d!:kZ.Q-7.pGIp /3z aTg6*Y^9}`w3PO ҶLfL=j- 5$aPFҊgJWj6 ywZI?vY6l:R =nOP6}jyR2ZEV z,"`vwR%OΟ2bPm//P8h[[Rj+ݥfIs ZCb 5qK4E. m=pvٺgjK) 3 =% NaVAQjӥޡ;Zl+w1=$t.#{uF>]Tc7m0w {6Spb;[Cɀ^xRE$bVֱJgnuʳ2dA$ zn܄b|;d@:ZEU4ڷnq."AzDTS.x3quZ7+plQ[oͩwdLCIԅ2%L#⺒X`:MDi<޷+R:5Kk3!m6 gQR6_SNsuou*jœ*"ܾMHŵVQ R/+x\m!NNC::b5_puMuS?uچna/2N4V?h&\-x nUXl_=Z\?BrˮcKL-n9tU)n\zvaLPK\&Abc8l.OEBPS/Text/The Treasure of the Lake_0020.xhtml}ےȑ?@6c252H՗VoUڗ $ (,I?ї5ӥ2~9~zCnR'ooSnqw7UC_6>|˧a ?uus{w^}yݷ'O_nxtZmݻ> |X.UvCih?o?+6u0O a8߽&a8t;NN~6<5V)w/}%^%>m؏5ڥzu:V0:|>ZU9jMՇNv{81 7&+*Q~Ɠ|znEMŽ[lM^orVO?ǿw߫ekimE~_oRzC\k;~DZIY||BxMԟݼ>O~w7~ͭ>ݧגmȢE ˟^}~o_O县 +}JfmGy cՅsJ%p1 M]T({UMUvqHMJ!6Ms%EcOrj[6L焯a>Vik~wՒߏuNoEJ^y5ځw_Wv11 oALʪITVz*k;:Lu//LJXA:5NCn@ކc'NYUOy%{Y|>ilf#& Ͽ>4q"Wf_nr,]Ӓ4AF׶q/GЅ,sUV,Ok>D8.E5:tQC_@/Zr rm.e|PmM4 ҜxSaMSٴ)b!iJ 3֐{Vl D0w(F؄4JHaBE08jj<c9zBf^0C=QXEOQԨ2Dte^مM7KWfjKG1V"npɶA O]T{?yIᗣkXHSEBU6+Qxwby kGͮ:}.E˷Mb['>`d`Vl1 착<s]W_%LᗭhaN幹3j8@omqsq7SԿ眃MEO `\k]6lQh6:nn ]c%>s`7q < '&#ᷛ4ZlV >L=~/W}hp+^O,ugG*h "byrICDn9B(};uhF(mh:YamN6vqEHu1*z Q !(!|hD` ~!_vAAN]W(}$#y7/nY|wv\h"ӝaF 9@|Cˍ<.c C$ؓ!\hx*[θ%~C>"mr"$@dbTbrPn1g nt J@X+y;^ZO3n9\=n'OL*@z8iOF]cjk@>c/  G 0@PvO0 r\dEޓ"C?!;AcOC ;6]-bcZ VWݘ2VKiV/ o$\Z9~ŵj<9a]ZW߈9,*OfGeWD 2ZnZB.v\$3ZXىv.U~YkkXxw\1F5o'[)NI!рg(*!OB1_R16nR쏺t\͗,+`eEJ(F2p# hZ>K~BPDeEaa-ˡmcoPmZjop5ǂ[T*z0Vև y~ް/TFQDAq3kzNȍ!ahFaMQ`BCЬ=bDѶ@ ÓlJ 7==D*ea`TP#4ww9A޴5aӚ$ 1LLG{X4H0;J8'0?2NdߊZʲ\H9=>6mH1wS g!*"daj>^ (Hρ)6CjA z3hD<S|ܫ(("k\^+)bKҵKwʐ !Ӕ۳(=./KTzRQ'D*pzUlr6kOk-j Dx(a%j+Qԋ xtpy$lXFv jAF&l̦Q񈂋/c5dW G`u=0pbu j~=NP?j#%wgP,y$^|'VU1iy~b 6rvQ0ub,t3?L0Ԃ( 4i];!DEA<6S8pGo^}%[c%}jG3L+6bGB {,")͏ `P>["qe٬k%~yU 9wq߷ߋݜcIȎ$Œ47 (6.MLj0eF\|ʳlMdQ@˴ZEpk80"02 F1|JDJ`Z% \-a1K*n`aǯW0ö Gi"2 a`x'KT#}+JfnDXt4,ᒲ9:q#N Bk5Kb~줘52[5SQZT14zw k/J#I/r+{NMԨ 18yD@\f\/UIـ==C rLwLC!!1@O8E\žm[$T1ľF?b:"kx4e@t( rf.##7M cbJP,KԃDnFb6uBc%2EViF &q<RM/k4d-`p̰FÌ;Nm iH"eJb%rN1Mվ–{BCl9}HfrȱܑnCAC^r0]`[#Mt0̡.ߏ XF‹{ȫ&r/tzQԗm3g.V4H/ :`lOL*Y*~Y%rܹAnm#+ 2}qHb!l8QQ% `.lQV!'^PI] -DYHlTfw@+´8Ӳ6e5V炣f '35%d5V Pdrc2gjFN{:B+0XNmTYa;H侕v,)l b˺8GKH傕6ХKXQ-Ɲ.C EAj\ZzH@G*Mg[+╖~K7J%,.@!XgUHc^.g5a7iSoS[dCcԼKɪSG\Q8z@JѬN4u v2<&RCsX5v*=\ٲ/,FԲwm;a5(~i6b EG00g*# 4/vX̓ 3+!9>e/o }uI$D>07Ud'G+iGauɳC9X8(2aSW{ޕzq*1 ;ӅP9I7Md41KLxMuLc5gX ~dzie/3=<)BUrwf}EϦV%1jI97(G4%p(!=8xfBC\:S_T#iw˼cQ e =KrY U?k1^ӱ@M|дr@ϧQ}P+" H|(Vm'c.ɘ]w6$jQn5=|ks+hUDu`^e)Fu@ %#q5gd&Zcx*82S4+ӑ $J _у]]e)7OB±@NۂIZ|]ԏ^j[r{"řCd/0kZ>TGb .Fn tvLKeMitk4G4Rƌ*d,SI͂]\N%2uo?8kj 4j7Bv5c 3H 9l޼8p$ K>Q𜿰,ygaV$:vLIcj#fg"+dfyM|D9A[*<|?ӗ\ZF.>?CÅqBb$B ۾䔔+R}o9J >5|;3`1"?k,0%Z-1;c#Ą)GB~fS,UG!ZDV> Xw@}D g4Xr-1zhZh&]!n**XM8{pV@I-Ɇ5RxY f1d~700}6~E(XD?hH̾4:ah6w >ȋ¦y3q^Jǚd^'.kVNu$='$A*ՠ_V䣾 3SE@|d-=LSz_TfhU,Nl*jp|Z"ϼʺC&nbY$p3o¥ʹ} w񤮹#kqrmn^؟AT }(El/,2=,_Mbb{F 2h{؛JQM'f˜K~趨WN8g,e#+3V;HTwVP%jypAA] f)KgYgtޯ}n߆ѯKya?+ѮԪ /Jar(~IbőL;,k?Ř:QtZpe|T c4-b3qod+c^~ȏGT TϐNARtARwOmk5WGc]1y:3:iūt kم^~B9,a-2; P~9?bL#_̺,L~,D4<*QMEKFzz%̨i98Vd<z5BcIA1 Hm<+yq/'b5\' ?3w?ƅNh٥dDD!Q6n ڕ)tMێպM[)na]!H+%IN lXhfFI^\U6]9(@j:4 #ԄI έU ( ¼ТBi)@XmAR"rUK1׽K7ѻN;B?&5DpƓjd_V,QAΙڂ5 #qTߦ8 s&w* -k%`ՍVu۬8 W,_WsťvQm&5~MJuz,ڎݛS{E-Zmm1;p@lN}Ae3NeW^vdahUHR΍,? *lNoimW Ejl23})NO"׸'h q\6wWYi3FV͓ҁl#6FXp#clCqcŚ Hm52ڴ<ZE% ZsN.Ap΂:h0<Muƶ, j4^jZDMwB #^438cN}d=V/mY]L_ -z~1, 0 &ԅ9MnlqU'f< A x;gȯPn:fFGBdit.f0n̨]z\ 1SFiS 4O6hf)jKquvu{aS7Y @Ι*ENz5@9AYBQp]YIzSxʔn["Ga*՟Oַ,:FR[F7=lh2/ bch%֗/Rl/nzͲpkWe|h5ȹ&cC%<+ -P+./#5F"Sy9#h_W^-Vy.K/V/MJK͔yUˬRxHDkb+\r4V*;pA b=}SM)t.=ˠM Vha_^< $g!jH9u{Q9%[bٍ$Cl=噀˙Kzx|>Ѧso3X5]0A Fd2hi$.ǚg*ر eTVцF$D&rWE!z|QRd8.jX-@؅T[}ݰ[Qo<.nYq _)=mwRm-* t vs\=$cki"pO5"zڧHPP^dNı*]ڢт˖]Cˌ΢A$N[hϋlR˙r7;*PB@iSL}^gp#ԙv-!6US_DMQ{𙘊1:({c};p_hA LOcj740_AMzg-+4]qFe>}b$L[MmR?SY4ݧJC?OSU 1{ UH^TăwO:*&4+otp1/GiU-ÌXQ{຦vTíLcP {ٶ4ȔիH漴63Ie?mqERu1R.a[Kci'Hٚy_;Nn,q(. Դ+p YTC) V{u܋w!kpXӆ?h8Ԇ A rR+??[ߚy}Q8|)QaiUh9f:bo3\(ʫ"=N% #06itcB ZfEf=r-Zٜ>LH~bӣZ!8la<4<3zVyp}g.0uI?Go8yx=\/ȹʾk e# ̆MPl) hzb;1dӇ%̰^n^[|wTiv2^8Oq%/6֑b@q;dF4hzhEl=e'+jT3VƦӋ>UV\ridG]g,bWp+eXK>x:-ۄ4O9ƹF8 ZinzU>J\IHwPۖ^h0]d;r{D/lacb<EE&un]q6+ 甴sy~d'h ZT#g>CGΔ<1_m/hY6M A>*m="Nެ0"5u5([p r_& |iL<苳KE1q׆ѨֽƒF^}9ͪ:DJeRi'.i։ve1-)9Z f#`Sn:M̏4Tg3lN2}8 ^8$)*r+ (^ 9j~ (NUpDkU%j`iթD' 5cn婵;OL J LFD#]C?!mi])B;e=Ny"I*R/}M`S3u##n"S/Mb)[?`"HݓjN@?|Ti0Z='G&:6>(L0ΞHWW[%Dy2 `{V ׺;Wvq[Ukck2',уK/%dҳ5/>'gC(^4G$2AzssǬd0]҈i ɫY0,-%'p!Sf1t4 څm4t >8 "z<}f`ll6p)`Բ *Q>k8{:ai{J9pe?cf` jza6#0ZM$PT|< bUj !i^GZ˴Ph88bF.C>H+ W]/Ju͹T&_h`]NwRF sTK\uUIQ,kM}uO,A+[ HiTH ?ۯկ fVǵyntt<϶%y㕤2N=t6cc>/Tk܍l0i8W?YsGce\w:~ǹJ拣69O0a'_He.f/aOI/LQ}b&a;yt چ!J;;u rwdG +qRzLSCybP4"9lMWH+?T/~F$ݭv /9׉(: V]5-lwY=:o٬sQ M_)^%R5˓2zVF{NgUC9j:N>Gwjvα7 V="Fç}U4~W>lq-hrfAsX-"U<ؼXȨzUƃct<n36@ gڐf:H-:1rMҎLݷQii3G=3%UqLE\m s앾h b!̭x]l8d4i1>Cm9ݾOiPMssZkk-dS1%*dӀ4k7 /st.n ZZa{2GĴR& eaH.ټ-gc4Ϋ0|XRKO8#}+;WÚ(g҆NČi+{A6?  >Q7h2WPjv2ul|XB[fS1ߔf~Eyr "fX)!TVPG%Qw6grJc\P}T9cBqCeRMn [s'Y]M/" C Nwt~Rܴ U.N(2 t}a횾4Q}:7@ӂ/c U޾uHǸ܋x_Um._XŴSELy#֕P:Gc]Q܈3Q '%+ A%O0|ڴBe^x\[YM/U&v\]C.;Bn_+\C!xmPm?¹iO5{fex%ɔ& @ޣW,_i]KNy¤ڦlQ;>S|tc6\ԂEe%=[{/.zfd BMκމ&|y}lC!h) E;A>0~<|.-psMǨ0EGgO3IaM|hޣAq9j0 "VǺlx3Q9زG{k2U.h"V?2|ڷYJY" :t/~@-OR0W S)NP5 U|;m-Z~#[]v}yfڸG9[Όuևn8~lӦ ?y}Gװ=y~v^wOcF7>׻|zqVPK\&AE 4.OEBPS/Text/The Treasure of the Lake_0021.xhtml}}ےqz̲ؑ)EfwS]vz DfKTvΓ>B_/Y?#Y=28U]@ ¯Ǐ;cUOqJ8|u*شeJsЍCfo_|[fO>nn?7Tᆳ^ܽ?CUtwq߿#?5ssûV)<ŦMc_-S?}vCsW]XNa:߿m.aj8{NZN~6<;>S_d_'.K<}9T8qӿosC;4)U^sN_7U*7n0Muϵmvײw,I׿jE]Ž45&r|g/~sZ,lHү\va3ݞzZd>0v|7ob?\8°_>ևyO|ӟ_wݯ\G>DՌJuB/?Ü~j,_?^5OrJחHovWiktXt'vW7z|k|2_ޛHˏ۱9땏_}yt!je U?isƽ\P [˱E)N6Vwh*qqfQITivaBhzw_ɚ~>.h,AntTm3֢p1MF5M. 鮺ȉcI~`EƾMQ/W: S14EG1Lr[kY~ձ9\?scq|z&yt~9v;_8@ݙ|t-8ɶsX/] Z":oYFYQ N:}pNw=ndCN~'Y\/eqloe"15rc9VmIn$3xﱯ/^|Q5Q$dSx(NxEdh,(?P8c7S@ȝH*+i!T O ˖=3:LW{TBgMކgl,PDףFf#F\f'Iqzj68rCXKqrbY eymP?$amn&hzS5nUm}gzqpP?챭=j\G.\, LJյY/!qdU"ۅ>gA =AvGFTjÓ9Q$1kGfR^> jL1iYeC-6 >q'a SL!V0^'+_M/X#@`-r'tQ=.O*~yu "SY~5=@=`-."IMEJpv0J;s}@׉*6ݙ`%U ղBsנ(90f/6:ξUN #@(FDW`+Q9G9y=z#z;;%zb_]V':s+6*t ('PءDzJfRH݂"k-dR?κ\U!؊03,e6wgm'f\CAٜQ\#^!68vE\Kz4ABf@=le Csm^6:-˙F8nrh*5Gcrrl{ٵ㚘W._X0*S#ABq:-F(W`B `EIc<QSm+iޙr%{ʵD]K]k)P(IdEMwa>,ٳws,1,s v>N>6.Cr%K}{ ]l,(Ɓ́@&H j'Pdg9aER=JJwuD!O_ ͓d0{?gdePv&,De-I4f@6Zǁ305 gInKZiSLnZ6]&q/p \lE>1Bjܦ[4,]V["*R^Òr u ppM$! ]Mb3@0 *1CU^8Ghj{ѓQ$xA$r ^e_pξLWCsl5KX5ˬfRD~$/ml WRw`,$(F(M$:^%t X`"ED"3%BQ-FRA1AX2ִ&(0( QUi=i\~+R2%='8@])f`1hp㦑;!)(>dž= NpzCXhxlXf5 GA㈿Q; l%eߏ)-C+A>&%yUdUD4( q+kDq"wIt,H伲%JbS3G=C _82*>Ac<tH٬11.k(`&"!z(zQnUԠ p1B=DV~mpl=@Vyl<Rvo:s@$GMU< K622".7j n.=00P΍&Uq@#FGQXH fI0E2i0ek{A/sڧegb3SYȮJԠ"R@|رSE M ˳|RRcF0lnn^e^Sb@ g宪2St,ҪcUyhuP?B:2X0$*֍'zʬl}0 Ֆ2I$V3Ugi/s!}E٬ #QySrс dFIOkH Գz_ h\6R$xKaa|$Q[qB7"Rq2UHU<@C+?1XҦ؞OrgDJrXu\JH Xnx'D8M uX$Ȩ b(!ݝdW:H|]s)0kq sevTSYZ3;N -%f՞7w/ &`#-vCʧ=i( Ymnchi^I3T[+#g$nS J4 ,5O]5J$ F2ܘ ?WaDbxv?A8T=Љf`*(՗y\TL;YSDfz\C^jI??!UJ'iYnXg((}N AVRs:\[\,{]~bΤkigiF ȓ̅wz'x#pOPM( p06+4pXFR͸VQ2,$5OAUH%97IhB%`"l"J9ϵDu"^#Y<`M=] :-=Lɇb'Dډc3~+@x~D/`gX3WE@j.|fc(gcmTE~OQ'<_BS,);dZbDLP%!N]]t'?Rvؽ *yJ`l XJlr(g *. Agj.d^Ș)6l.FD2iܬ,哳N4!^Z+ϝCu=F Rf,E`@%bf+ K\`Ţxo#ZdQ$dB> k4~<99[x"ĢV<ؓ2R h °,%U 4)T$jV>t HZ1m 5'8{Z٭` G 8Өfb|v`$WX^I/t<:OJm_Nf"3r9e3x趹r7Z|Ƚ8%5^ {&ˌ,py2/o`tZ2Y>h0Xy~͛p3vRjӏ@cg'ISl|Qp1'7 pP2*cgdVy#m@հSWn$'Sw,-w!c6 ZQ_S z>3Hʑ*{VKbb;6rNȕy(B.[ 8 ƸަYRux,:DͻAp'BiZ4jGfxȷn3n;ѹ(6:$3(obI5]ňwDž  ~pIVJdlBWxamVʨ 4z?Vgy?[}¥U:;C ؐp CFW 4)Qc{Y#\+s͒T^a CM]zj޵9wȱdD{  aQhg/5uQv&ȸg" m\ f :*cHޭ:(H"7WK>/YKH=7hڔ9{܎$ *և'D'M|cwvz*0Fl.(/!_[VDsJ-n'ٺgMˮtq%%6k%Л\J'SQF2t-1ڵ삂AF}v TNmG5Mn88 uJz3䊰kA&x#jlvٗɉ9+:pvFI>)ɬaAէ'}o%VdkiU~d]s75DOQw0\8ڡNv$hd(?:a$3ثǺa<:aԦUĐ̟HsJ&f#v jUXsyب:Kǎ*;eJXN˚* -J80vYʁ@Y$lT"1I,)'`I;"e?ʬN3Ј}x C(fq^5 U Dw3ZpӘeT޵Vq0m9UmիdcjFӷ!GA4ßz y-e $k@N᭔_xp}2ݘSYrAdeiQ%M29buQ? G?]~$[I&CR?i5:asȄl7l-j+)y7LiDKGZ 6&~]}B/'))7hvWf1'46TH*֝aU&bUIÉ&>ߖ^!HCWdcgWW8/u܇jd7!I;H^r6iGS47Q#O $ef {%XJIuj&q7S"qp̖)끦9krp ,\PR5}PׂbOH5\x_dT{/=4v&47hsaZa`c O+o[Ck6yUB"x6soτ =^Eb]j^5ٌ2`GcVhvZ6b,ο6Yb>Vr,CjtZXtW.\4~kƳrvXuD?Pl(/V>(g+T vG4^i;7ג0"i:gQ0XMOѲF6<%c?Ezt&rO6JGӢ5kɆc?&;Ix5"~Ā!x{~ͿhPy;67|д$%~8l.t"9 wM Z5ƤZ4!]lekq/+h0nUB"LST^`f-';*w..Dcbԥ(YѼш9ɮԡ}+'Q0q6L%8HK&<{K>S͢Pee&πjTtԎ~t-ZsxӎZ7Һɩ2 pnUD:nP} 4gh>w]gn@YixD׌xfcl)Z-qܲGE>:Vc{'0u*e?St%IJj _Rj0oC܉_5/+-=/!x;wz$jwgeH]ӪR2T@5,2xl9}m%Q u**)1Ѫ%p:4+U m|1zG8N U=ⱍ5H,)"hC2v^'M;ɛFCwD5'B< v!+b;SS1+6TZ. [+\5uV3sM *ώd+!1VG$$[TT* +UN9F7hLs ެ;gӣ]) \ҋb%1eO` |&5kFufY$r!7>odQbc}JG&-=V<45j>pG?7NgO=,xgG.d nmZ^vBM&V,uR C.kkHF3c@I>EQ"OsȰk:XAyahu0h3ΌjQv.~rJ1J#<+ gq> I`5y'&噍%!"⏳O=̂K64ș$E='CZW:䡼05ji@fK) ~z„acF4*!.[y[>P,GsPo.l7"N42'W(i,۲8i'q{5U, X3Hsߩ".;n#psAJ5l;Y"6or'sky9rEBC?HQà JWshH5{/Stbv-r 脍jhlщ :o$;YQ,ڒ~4f`St5E陏(y9#V`k3y!j`QNyD`64Bhҍ2Q"KOްR76{`éhHAsDZT]i9pH3^9B [8noM#' f۩΍)_~bjpjݹz5+/\NRo1rgrA\HI{*pLLj{tPZ@bK Y Pk7$clEy2 2< !wZcZI{:E/WX܉shY$bN%#lǧU2M- FvdgܦOʄrIٕ":&ep&y|F2>2^N-E#è]zZ.I:LmϦܷ$Kځ;Lyk$ۡ6bh+g$ѫ.^;ODe&_Jd=c+)gm6V|mJQʃӱ+ Ca5H9D J-J{ XcJj%Otq f`n$D:lr1,!ġEZ/o4Gf){}d8Q#CvY%*4^cA؜AM64-cF—(c.δ&w_>̙F؎6b>d*ք!*V!VlIE,Pi?eЧʓkv:#\;2p0Q3rǭu((@!~jNB#Ib>p~FjS3Jdp 2 QHqMmâs5^`;`9:- FGPΪF4B!Y^*m>u<YL0/+0 w=- ƘIh*a1FEq"ZǃnM^{͊c{?j#*_ 9uKo%ٷC hZ]Z8伥B/Ț[P6Ȼ0mPWyΫ44Ru)b9GDx ea!8<2\[y"Ey.W e}G3lr}#ϾϹ*9ľ_XE`q2y=a痉nwC3Gde)?M_1#^qE  'jhS:1K[Q.U2] { J8>»R[CkèB"玟P$+YeX%|{KLJXl5]>P9 g&%W~.tk11OLBeF[b(}7j5m`]֥ mKдּCIп "T_o^ڼx'?=i.wmQ.բ.woܽ-~w݇?w^ J鉶ؼ8~o^lmCq&9-ٻJkSWWܴ^+a<ſO<⶛^lK}]<,[F}1%= )C@i wd"֬')bg,ǍÐ}/x+70i/w?b,[Ba]5?:[pr/IlfF6B΁ǂpi2Y,Qcqr"S-|>z)v0`#DF ow9Yll!OD[e^<;M#9kYGYrcIWJ%e/ KA>OصQ:2()7Ao3焟+`:-0 L+{8#_k̫),Ɖ"{&>(7#J+DqjGIV&ږ"P8pntu NAͣX(TOrjšGYt 3AAenmzeoVe1t(r (L>zϷ0ttOtPXG9ϩP ƾv y.PB!'ߝC7?O;*Iu(RSGkS-0ЈLZ^{ynH3zjd}`a40._]e]pnjAvR$N}P!*Ps:1"GQ^|rUn?#|M4{)fHo8Q㉆:IS0ĩ?)DE3T0S1,*o+ə07+I=IT=v6=f2 'dS4)Zh"f4gFo: Q^5EZn|HN:y 8.!hY21pq#HG@/CGs夡 p _:|=Mۆck!|jJd 5-XXL\sK;]cS_4sث,%УoΞXk@գ!2F C~VmfO{<`MnHp, Ue]W !"'?JduFq %q ,4Mw]|#Gr/; X>Eĉ B!1 |tW4T\K2V( z$Y_;N؎V7ܓ>by1n%hFt[E ǠX0Pe>`U,-"qz mfʡ2;@r>5_x5/aDB->sEaEoc%\XL"N,$P:f"z 1Cߐ.0wqUv1[.6^˜62>8!DR4|ST@}WeJhtpr@)p$tEEa{E$L|pptndB,˴8d'(LJ#4: -WXY)Ya 6[&3ѵu#ЙdD"8Ϡ4)8Bl:%BKGQWDH&c%v{8S<;ՃA@`aJ;jDeY1Ś a4t?[{[=&TF:V1j i.환DA&]!jh^WͿ#@L(أW(i x5mO1c8OL0o#іKe:OhV"~E(` PQƑjSO'=Q0;}E4{Ճn"Y.~IbbD1";ىČ?WZ%)S|l 4G(X^73l&x3(6Fe|ƹ0]W3[T)6|hGMV&cj&)9ߜ /A2/vnh!j &2\MCp3⺱dXP3P}FD7KQ#@7oֻ| Q6#Su{ ĀQ1&ꬖ me2_ 0F<]%w*gAvQqw>󀚔 ^At:Ucw3Nu ِ(c]UVO.0%<C#Nl9h 3t 5^):ʗErp^KMB;ĦhaMMѰU!ɋ7ȱ̔؎=BOa9,GYCDϜVmݕ!؇_Nd=>7[)1W'0[T~ 25=^N`2GMFIN/Ԙ!1Yk k0_,35ZFqW[<0b`/3F$Y+:-E”` W ߞ RU><)Fr`-/5#W'-I/^ǝre_8ax:PkEEc(nM5;^ta)뎉H4%X!ABFJ,ڬRg$c@|M2@ɍ}0߼ &ژsJ~pb9J^YPrK_7y@qEA"JJ.~`e5ȼo_wT'Hkr W.Ϙ! yNctp+E_(ybP&Q]N"&>SE6eSW DeקHt&W`+@ݲ D$PU,Y:fWrB3ȷqߜ>Ys:&  ҃dE̠+Kj0pWBv(I]3E%1?oX-F(.D}%(U#%fBb_f%5ݞ Eǂri[măRTa}MY --=="@S&6FC_~Z| eSf //@_itjEH2Mpk(idڍj0B"/NMMBv0Vz5L0RieaٵN=SD*K "Eʬ-0*|_c抩D ZBN%It01pcW~(>TUKnr1[Xֱ|{K;Rh]-H^h4h@e Fik!qX[Yt!ਥpfYc+BPaYݪv8JAHC&L؋j@?>TGjd*HhKqNs`ah\yYfCxalcK} wL&Z?*8uJXUjrE\.AÞM="ͫDd O2h١UG"zQR$5Mugȉī ,">RFnO"RǂE\Ltfzib# 2-l̀c赨8_1TiQ 6oYsA5t}|ˋQ5!l3qRD2AT7Sw󑀊})[5ieJ(WFn[PRA蠾#i߷*p21: *qk=8-2*Ip3 .PNVs:Qv %)dLBdlzx~h? RtBǻu:EtIEoV\/VokWEgH1ɲL^aed mJ4m#*LM J<~ۥTq_IU ^kĤ`qs@vjlKca1/ @B,<Nag ,r&.cdQF\C+>ϭ(e5+!tveM Z1@ Z&+'/ ^L٧f*+y.Y}2ʩ,rD0e9M{%͈co۬JL|T5o(%֞yL"ڞ} s6NhŮ*ʤ]6-NLE]95.εJe @e-YV.L`Ua[nPrhc~I䩣f#7@n-.smhP |r#j4ZYd>NÊfƒbfy6~8wA[ӒZB&Α`#n4mC #$ĄBL8ұ}تs KK5DMq7<ԋ=GjD%)֧AeyT G?-y5)II{t=qul(_R42^>,W]5v THRN:{De[ey IR]O@H_Z_sG(-t9Gg)zI̸hR;4OmyԄd/[vk~SpSR8 ѝ0.g1-̨i&H361 3Gg/"'\SꫠL{`F͢al"0~=Wql-䠴okt{ʜsW9a%Gb- d|>''66nH<uIYʛeR0X=.h'únB|֦3kx#yKy}zYޛi/X}Ƚk%ц<|+5,jhz.3V!#޸ԻI›BZVdTbKf&}Up$jS:S#h hQì @#Z's;Nvq IIO}@j=G<نeĀ~}s" [CH= !%ljcާ3PF\ }MǑžhVhՎw̹5ک!I&Ve0di*EƐ#AX;KV/rpVD*aVBIX֕[W&uCwA]dC^LIDĪ59S'3M<Ou`YXg6V/1M.k"-h5Y!Z%\=K,f9Q\8kB^VB=Jf Klqp^ikmsٞ[^g0 @|tƲ? %^0(J$ P6߲!|/9l`Ц| )ͩz&QYo4ŷL@I7eN jkA%d 4DHu^#ά)mj[{. R^6tɗ]2HZ/0m.II,YT՘z\SARi/6݊ig`S✇gR!auVSS'^ KHrOAKd]H; J}\aE0؈kә?X]&[g_1ke!ڧ"?::v7۫-R?+97,7g ;*壾+ٛ玫@+ o}f>cύ=E:pyDJ}.'o\Aon0U7o9hv !NLGXm.I}l1ypfezM@?1y qqU>TL =.*:3"&DQ=DӼ!3KX|:a)Q, Lr@ISU#;sY6+˹4G5~N\9ݱRPa}fq |1"EĨ\ub˔i`":FZf',TT]0L@jAyI1 J4`7&2*0){=W|Ƀ~;\TySM4S0remu {qS. .q7brP0rBU//S{4W:H My]AO g}"QStq`+˩fcH 0V2"֖)E'[r+6+ HRCY<9REhm.\LQJ%.v= &\{we >[o30%k_6/K4?|V"%}u;̹~śOPK\&Ae%1x.OEBPS/Text/The Treasure of the Lake_0023.xhtml}[v{ >DTa8sTlRd]I,˱qS 4BȑRk}Y{ >6ŽboWO_ U}ݷi^Ӫjv>z~z]GO|buu}?~u~(\_qW8>?aw}G|'ruUDwb;m1 ͷ˟Nz]M?۟C퇷nsC}oк]|'Noqu%ϔ/]K~W_BĽ<iGWT}7nvŷ Ck?a')0:/.}1?dUtnUq͵c06,HQbM^ZEY-7!uJn_~/⯗߫ekôiBFn3ݜjd]7xW>VC87w&"W/o_7/׿3w/Q=duvn?E7ŋ^(ty8m~{||/hBwWv^_Oxueo]Eu 6OM?7}};OI_vrOZ={Oœnxp]Q5.5.o_|ŋ__~5.~&O2=:%ggw܆!Wev$A.)yX[4E= b׸QkeSHHͿ6u'D>jcYøǃS3F%.kܰ۴7> bE2Y\7mOً)+nx7Y]_"Ciqb"ߧ P(u,ѝ)RyS1=b?t8VgBՖEMÍGٱ;?^W# E5#6ߪ\\$7˃Qz3ƟN;Y5>m䞧".:bD:l}/4T^? ^+X|dғcGn/GWE۷"a8x1*' )~<CƩnN( +(Erst&(q3Gѽ=nԸnj774ّ,78 NpErZȟ||v,M ؉+밥 }~7}bJ"6wcu]/ *yx}!$P]n36A,q/zSu"$@{D)v}9|7%:mưO"6;7!![]`|^H\Q8*^>,G/{G@ŃvV./w8a-KC$m + 1}r$j>xW}2eh-1ߴ/VTl@`*`mxuw$&: -K!^^A XfBqEzʲi fkl&rɊY(ߔ3mUـRoi7˗@˥0}'Wn`@WN(ҦP/Cq!zusEjio?⥂N]lB4hd2)O%>MTn] k~?[HU'jܲU{2v=YbxW_ſN+7jqSR,Kxp|j׸;R|]|mzUbB*$|@ULX:.nOqe2rw M5M_"Ɒ7w]M,P^t9+ GAGe,Tv+U&=u(M?e$o7WEv~Xo^A>=sT>,iU/b+`ʌ80R#U߿uqw_|Pys/o|w Y)QI$,:8_ƞ46fDVju'͊Q 8CZ;'qt՝4I>s Gk<qMɒU?uz.N%1s@tu4?\ qF| WyfTFXÅ@LҖ~D~<"CN]B#}#ŠX ŠX؊>yoKgw#}g lk{3|b"*ュ-@rZ ]&æp;-lDŽi<y&Dp. i Lr_#Ѕ:룭m{r@!6aQ#AR[N/bdva @ !#J un ub:Na%rKWu!&MbՂrb60KXζoӺxc_X>k n48h1`[Ddɝhɬ\A[]YQ~3uK;oY40{p!&dgZ\R%M8jt?od/>E>%ʁBc||E0Bbd= gյxN,N)TtгX,&3ƂA|A Q9Vy`&Y^GD 41ĺoK󔴬L D|+Bw*SMQ/gy^E;2Al)m}`5W;5۾[ōS'H0 Ma0c逰0+3n20Q݂n: 6X݅ڼ5؏3#E- DE@ 8xr}"j̛pQ+vxq΃rMA']52W %\/@8>Us?UKpY-~+u*w80`~D?oh`'u)L`ߋ%?w@NIBJ,agO*ђ 6A ) lP agJLǂLkFV 0Tٷl']wDOy)9vꎴx$2UCpꀹCN|}=c`>aЈ"(ː+{_r!Y ͦ]:+/nTn%W1QSpCS0ԉ%HnM$Vm|5#זSyOyۦwv X%Ulzrリlp2씶+3+Ȫat>vmUT{_hХ[#+XmbUc(u8rl!rGbuRVK3G3h߹F{hI֞e\Kq- ?f3`1[6l;Lh\8Dbs4I1IE- J[V%)&R,fH8WA6b fO*W)_qGJ_n)K|m0>,Y#R!qRO夒UI0.=@)q%A$I B߀tficN YR|,tzJ:;k#hhކ-k&oϕO6_Ɣ7@9; \d<O`h-QDDy:[k*ϔӗS[^ܷf>CDgHJf >k||Ѻ20Vbe% dBTT!Ʉ|]&17tb,\B^ Oڹ_K9蕏 fBp[8PVd5 *qu]5)'#cVj5y})0M2HN4L.rb )nm5vH<^ZF ,A䊐əPC3rk\5i8'Zت*B#6A#O> 7*|4 <$|ZD#6F9 ̵zQ++dzZ5FP1'LQٹ!".T(cMd pۤ(XCdO+i*j@il~Lka+'C ))Ge=APudq?(kD;iQ\ O \Enq볛Kmj,CGjiTgYTU!4.Vz\,T4j4"—$$N?"F:,1N-V$0S1Jd_Y( L,/jϣ3z/C=>-Jxqk Ugxa[fd}?g5 R4OS\•y-M3.}GyrV~m %j7&f̹ۈ*|X K TW[OW5yL\saRI헂 lAq/}J{[MU1erXFv &79@<s :ZULա"Mcb5PѿcoO DbOZjwjӲXeN+QVT>N˞!ύ؈Eqk]Ν7R꾝 ?y`N:9w(#UOU2rDI`GˍM' pNNI6}ZֵAyyrV\ x:b0G BHG!!4,^wfș >ÄQTwX 6n,lXte(mjc*7(" %37#i֨~f`|m9!ub46Iz xaL)RznECa!Z~joVEg޴~RQL-~UDʳ5NZ0o3&a#$ zotN=hLL"ŝmo};9Fv0u{i`H\Mqº{4Bf{R,3{ew8] ɛÊI^^:ҠR9}TKb:!qV^\1 q7p#2zc!Բ\#4!e6l0pmƳQƭ_Ԛq[K0Ib# &d]2>RAܦIչ %yQ?,ȎTX*喖WV?ZnJ5!a#f盲"]s@T.L*QrԹ 1{"oi)[Mvj957m`P[S4A"7IH};0PCk@>ō3~Pn]S}͘ a2K|^xXnMC_xP %Q}aInf"[Q]RZwX8mzD41uQ2gAjɀ`71 azgX]6TrqCʃ68fR`Y/|`YZe4:]ZrRҸb;u h#Ev 4Hw6]Ϟؖ_c(+T_N T5ْ duxsR :$Pط-85s,l9 $ D2+.ja>dUbqVh;fZ3[LۓmDt"C pOJW uF~.z\vb8ܯV~iCŐZ\~i2pښF=ui\ 2*WyCutvt>'!T>u)F-؂L8m;ƢwT.Rsj>gP-[jxIђz\aw<iZZIQ+6XރH6#$}dfG6N.+K%ΝNp4g؍Ty:K]m־44"PZ{3nӼM5Ks?g?47, {[K4QSYսQPlrvy3*#j-]4+? Bux<*zWQO'RBdAtjБs9]D-]'/ Q!LZP"֥VMDzNX[kv;;9eAkp!)F*jSx`:# X[РgPX\%$? P 9fC͎Mh L 3\V^bwjGALt#SdHdt{~-$ sqWw֒g@3 Rx¬9I*0&^б8bjUy@>zTVZ- O Y] ,dE7%B)1_[{ī~hDqaG!IO`h517Y"'ޘ0Rq͜L[{ϣ\vK%$93 4畟 ͜p@5%TBs2( wKQ֘q%䕔eԡX(\2[Tf᜖Qu5H u0%ƹ5hltD\`:k1f"mƊ(9^.zAj%YF$J 6 b%,ӋuO:ӿ:uzBm {]^E[ۺq#`&P4%&eBn[$S\uTX*3K-F-X],'FyçZY 9 {ki,m7ޑGQy*+_`Z# TP,R+q m"$=jHq؏,/ܲ-+e#Z Ku8/*fuZ5ِ\nl 2l=ເI6,V(ΘtF+I 4Z}-XL⧊T"3H{t@*N"V`)5>Uim'4f*@g[; }EU1oRdXĬݜR?U;ϗUvMNv~x~֦M ݳҥea\dԺarv&kܝ**zg5Z%k=-b(Y'؏e,sryH ̣s;I6esL@ q ?'< lfhSRh vwo4WPlPv4) 8ϛll4nZ29A[/ Vz<&pFlPl5CeD5ILMI0ޕUiK c1͈ `YkѢFx)MpiXdHs6F{^rG g7TMT4^|$Qo)Y֋ s{Y4KhCVg噕Ķ#qp \ cRԾ shF0uw-_\fnxiiQZYs2+bhnF_Z5iPJcEgDLeb;`GWLčR$^# e!˴IC8jLVw(BmS{˼9?qR"dmks-qS [tEcXY26 lSYUb F9/PAV!A0׹@oFL̨1ș7 'FVR!d$m|E<{è(R&ht#Zp8x\՞ ]ۧ-ĩfOp0h]<4 S WdPN3AJ.gSCj^_{{/,Nhwad˃\]ލ86eӫe\~UٲX3/jqFBͭ.34,OO ϟoi8IQhqUrYjBΧ(./gZ^ lqql?TGZC:Qi)7[} 6̳6LO f}˵*r%6t @&bR~ErBv%BPO2 !\!Mp `}d\%Okn.c0VO WLϕ%uOz%¹afЩ%:2t!]i%6~䨻H3 r' ^@k[Sii&hB[óژ\čXoj8xDkmxFaB{FbCCS|X5[Ƞn --jONDaFP2,ho1DZ_ cñybX@Ƥ.&u4wDs^X/& Kxe:%rqUb[D.Ƌ: qQ́9~ 0:1ߺ*Tysb E8̤f,VT&(.N&Y8œ<œvfظ\ޤ0agsԺ?ܞaYz'g~<leVk j)-$A9Õ~-FuF<َ? a}Zk"_1()ȷsD8PxEn%>Vj/m[s<9;'&/c [b*,XNٟ\{ ciI=4Φ!MQSORԟZٞ%`.^GC)@JgdK쁊u-4 T^4.Ŋe 2N:µ5 [KǸR즍pA7iPO c^w  XӅeǹԕSfFO _@Ȳt&#$/ o=~&o?r>͛I9mf}H2ޘ5tYy~ne_0V7LaSXôK$C1KcX5?)yAyA3Jjȹ`,WeU궦ж>F8Cp'9z!Kӹ4 WTΓ86<(deŜ9Կ=L<_2jgC񜃩 Rûrtf,Y"ZpkE<*c>2P%5KSDk&g9Yc?2h\`O[aA"4o>˸톿E¹NS9`ʵr1ZW{ _Yܗ{OJ,N4в:3)L=-wNoJ^D+_CTխ : v WpqJ0uI#oi]kGt:+NZ={Z#~5OzUġo޴U\nUMϿqL~5~WPK\&A}2QD.OEBPS/Text/The Treasure of the Lake_0024.xhtml\ےƑ}wK+ K#2Ǣ$jQ܌K6,tORBVVɓMnb>^<\=X]4n/pim mxxtOFY߾z??[{^sj~y 7XC<^c[..\7tۡk4ԏ_V! kV~Z^XP11 ]3iO[+VŅS^#"?ꫯTPX`w0zWt˃v{۲''=}6$r4nJxv6fi^Ww3+wm&s#{% (߃39/K7]*~ּ0!>0IP~ix F?˷#uFYp+  ֏rp'JJ~ q J"V@$܌#b`#pPKfXsDVgOܛosﲡ%&d8{o]WF]BKoQZv6eUy `0o s>%(?m=~Ӝ 9(fIGj2JIcN"d4O[$e5tls2܄m듫}agrqvrC@{NeX7CITXڊxP(H.`!-Z@%@ m"l++& ,Sjt5 S͹cL,P4/Φ#Zi~ϑ0) c"shA3̌LT Qc$ Vs8ȹ?-_N*.]E eTV5n2HSpO#Q`7^PrF2)d4P;>7iRUi78^@TDQA/Ryɡ@mY}` cCvW@M3S[)Și x1Qf$c\$v3.0MlR,3-7 e|a,(6j惺OG訅 jm(L Rr2҆tO389ZL9Pɀ2p:tt6cL:r=m#QfYIҤA/$=V^K13P}`WgX ztBaѠajNdSҴ#>eJ"(zyN(3eD: Y#WP6`b\z9M3~%XObIcQ`E\5.)Q :ᏢQ1:K#MCTyʹE/2_W@-% msЪlkqC&,)}4 h4X.(LUupW)7? >%P8S"?H`2Hx͓%n!;V襵̴^(Dj8X#FZJ- =oVm6+Uޚ2`mz5)Ԃ"<|jAXMhv2Ӆ '8:铪*TvĘ2-f,"8r+Pxz!KGB`vh7=o5؍7٫AF/}gɎ u~ewxRJZ&gV|a1[Ʈ9/JZ-p^ʳ{&"%K aKe36FV+@h8JsĽ<5T G~%r O*Fo?*!`wE2$Z,xop ȄܣAVҳa/x&oh' FIDca}P+^x_W |J~[ln<$l |/g,e~bYSKQQ.^w(},e.5xhFe/ܦ H:|wd[m#jQIQ!XeB¼S_!)AUtY/&BvR:۴#1i.snY9P$LV1đ pb48O#x J\vN[*nG1 kE\&8/*an1FĶ9K݅,&.FGi B­ne'dKT %*+*!zXdX'h%!wjMªA(rn&jP:ր-u*w(>")b}t[ssȎc$VjKNv/Z,q3]%MV.-ɛ-Ikr`C8'jcs׉/-BB1|ۡ%P$Y"M1xaoג4Q 2tMFͱX||~ !0Zlr}{UG.j?GlQXj9H$0Ї/=樹huJoVf#v0 т(&n;73GSvKLpD %^و0n@wv滬ͱԉ] .޲@9Ds⋞k$GIƙ{>WiF{h}>V,`I_rg$i5J nB$j<( YV$ vڱ&M T;n?jjH׳ǁi4P4VzmG:Ju-;WxK:m0[%RX<)g Yy;F CG&}[ [m 6#E.Ɓ~D:뗰,e$@{S48rVs 5Y*6`+lm,IE&A]ٵgJqb?2LˇL"Wi.ӤVE`n2XQ[ƣ1irc(WD;qXW j$>[N,5Qê(EΏ{˷vNxJk Z `wFڔfuKII[~d<^0dxl.ɒu,v\5SP+M]qCYs8Gkî|Q˫/K[r-k{ޟ>\QXxSeqcLV h\o|q=Wsv),ש ;BGˈbRf<]E@CWz'W31~&:|.C,_̘N8rzpniAAф9}S̥ E9ϻ􈚶XK;5WwXߣ%,"aH u\Ceι?TnE'@sV$꿖1}a^6Xfs&&& B*vydp3_Vr2!^YG6 b'.XyJuWhC!g#)wr? d+ ̰v2G0RɈA]rI=ʼn< N!x4ΗjTMmC<)T=j;}Y}kgSÔd91BJ+,حnY ~z>ajQLt̓YVTZ*i͵l~8oTkٿب16qmN_$ @Gg;[:1C8<6?O +ݱ5G^~[8^nk _*OG.6ćuߚ'5 EZU^o ە+| [32Ǚ p+ 0GR 9ٖSdD;2z?s>@hN ьx/q< C$6jްygnre &u4L_-/o. ,5OEBPS/Text/The Treasure of the Lake_0018.xhtmlPK\&A0\W-m. bOEBPS/Text/The Treasure of the Lake_0019.xhtmlPK\&Abc8l. OEBPS/Text/The Treasure of the Lake_0020.xhtmlPK\&AE 4. jOEBPS/Text/The Treasure of the Lake_0021.xhtmlPK\&AՉc+!k. OEBPS/Text/The Treasure of the Lake_0022.xhtmlPK\&Ae%1x. )OEBPS/Text/The Treasure of the Lake_0023.xhtmlPK\&A}2QD. h[OEBPS/Text/The Treasure of the Lake_0024.xhtmlPK!! ux